PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0294s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 376aa    MW: 43216.3 Da    PI: 8.5287
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0294s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY483.21.5e-1471737341385
               FLO_LFY  41 aaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkr 129
                           + +  r++r+le+lf +yGvr  t+aki+++Gftv+tL+ m+++eldd++++++e f+++ll GeryG+kaavrae++ +e+e  e++r
  Sphfalx0294s0013.1.p  17 TGMPRRETRTLEDLFDNYGVRHQTLAKISDMGFTVNTLIRMTEQELDDVIQTMVENFHIELLFGERYGLKAAVRAEKKAIEDEA-ERQR 104
                           445667799************************************************************************966.5555 PP

               FLO_LFY 130 rkllsedeet.......aldalsqeglseepvqeekeaags...........................ggeglgeaelvaaeekkseee 184
                           +  +s+++e+        l al + g  ++ + +     ++                           g++ lg+++l+  ++ +    
  Sphfalx0294s0013.1.p 105 TMSFSSKSEKkrrleggPLVALKEVGRMNDVRMN-----NNtlllpeslgqvgplnlntkepslllahGHNCLGAVGLLDLPDDD---- 184
                           5555333332121122233344444433333333.....2224444445555444333333333332222222222222222211.... PP

               FLO_LFY 185 kkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiaker 273
                                        +++++++++  +++++ +  ++ gedge+r+rehPfiv epg++ rgkknGLDYLfdLyeqC++fL q q+i+ke+
  Sphfalx0294s0013.1.p 185 ------------PSSDNSEDQKVGKKKQKRRRMKELGEDGEDRPREHPFIVSEPGDIVRGKKNGLDYLFDLYEQCGKFLEQCQQISKEK 261
                           ............1111122222233333344455699**************************************************** PP

               FLO_LFY 274 GekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnah 362
                           GekcP kvtnqvfryak +ga yinkPkmrhYvhCYalhcLd+e+sna+r+ +kergenvGawrqacy plv++a+ +gwdi+++fn++
  Sphfalx0294s0013.1.p 262 GEKCPMKVTNQVFRYAKYTGAGYINKPKMRHYVHCYALHCLDTEQSNAIRKVYKERGENVGAWRQACYLPLVSMARANGWDIEGLFNRN 350
                           ***************************************************************************************** PP

               FLO_LFY 363 prLsiWYvPtkLrqLChlerska 385
                           +rL+iWYvPtkLrqLCh+er k+
  Sphfalx0294s0013.1.p 351 ERLRIWYVPTKLRQLCHAERIKH 373
                           ********************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.6E-2919111IPR002910Floricaula/leafy protein
PfamPF016981.4E-95188373IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MNTMAQKDNP LAYEFFTGMP RRETRTLEDL FDNYGVRHQT LAKISDMGFT VNTLIRMTEQ  60
ELDDVIQTMV ENFHIELLFG ERYGLKAAVR AEKKAIEDEA ERQRTMSFSS KSEKKRRLEG  120
GPLVALKEVG RMNDVRMNNN TLLLPESLGQ VGPLNLNTKE PSLLLAHGHN CLGAVGLLDL  180
PDDDPSSDNS EDQKVGKKKQ KRRRMKELGE DGEDRPREHP FIVSEPGDIV RGKKNGLDYL  240
FDLYEQCGKF LEQCQQISKE KGEKCPMKVT NQVFRYAKYT GAGYINKPKM RHYVHCYALH  300
CLDTEQSNAI RKVYKERGEN VGAWRQACYL PLVSMARANG WDIEGLFNRN ERLRIWYVPT  360
KLRQLCHAER IKHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-1002073744171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-1002073744171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002966714.21e-137floricaula/leafy-like protein FL1
RefseqXP_002978027.11e-136floricaula/leafy-like protein FL1
SwissprotO044071e-153NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLQ9LLB51e-164Q9LLB5_SCEDI; BotdiFLO protein
STRINGEFJ206841e-136(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-87floral meristem identity control protein LEAFY (LFY)