PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0198s0025.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 597aa    MW: 64874.7 Da    PI: 5.1249
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0198s0025.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.34e-1362215941374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn.sseelaalklfse 86 
                           lv+ Ll+cAeav++gdl +a++++ +++ lasp g pm ++aa+f eAL +r+++  s+s+ ++++++ + +++n  se l+++  ++e
  Sphfalx0198s0025.2.p 221 LVHSLLACAEAVQHGDLVRAEETVRHIQLLASPPG-PMGKVAAHFIEALTRRIYGgtSSSQDSSSCNVVSYESNNyLSELLHFQ--YYE 306
                           689******************************98.9*****************944444444555555555555344554443..9** PP

                  GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                           ++P+lkf+h+t NqaIlea+ege+rvH+iDf++++GlQWpaL+qaLa Rp+gppslR+Tg+g+p++g ++ l+e+g +La++A++++++
  Sphfalx0198s0025.2.p 307 TCPYLKFAHFTSNQAILEAFEGEKRVHVIDFNLMHGLQWPALIQALALRPGGPPSLRLTGIGPPQAGGNNGLQEIGMKLAQLAASVNIE 395
                           ***************************************************************************************** PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f+f+ +va +l+++++++L+v pgE++aVn+vlqlhr+l++++    ++devL+ + +l+Pk+v+vve+ea+hn + Fl+rf+eal+yy
  Sphfalx0198s0025.2.p 396 FDFRGVVALKLNEVKPWMLQVLPGEVVAVNSVLQLHRFLNSDGGPVLAIDEVLHSILGLKPKIVTVVEHEANHNVSGFLDRFTEALHYY 484
                           ******999*********************************999999***************************************** PP

                  GRAS 265 salfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           s++fdsl + +l ++s  ++ + +++lg+ei+n++aceg +r+erhe+le+Wr+r+ +aGF+p++l+++a kqaklll+ +++dgyrve
  Sphfalx0198s0025.2.p 485 STMFDSLeACNLQPQS-SEQLLAEMYLGQEICNIIACEGVARVERHENLEQWRQRIAKAGFRPLQLGSTALKQAKLLLSLFPGDGYRVE 572
                           *******555665555.555666677*************************************************************** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                           e++g+l+lgW++rpL+++SaW+
  Sphfalx0198s0025.2.p 573 ENNGCLTLGWHTRPLIAFSAWQ 594
                           *********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011290.007438111No hitNo description
PfamPF120418.1E-1044104IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098565.979195574IPR005202Transcription factor GRAS
PfamPF035141.4E-133221594IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MMAFRNLSSR SWDRGGSGGG GGGGAMVDEG QLHNRNCNEY TSTVHSSDHH LAMAQRLEQL  60
ETVLTAAAAQ EASIAHSSSD GSMALNSSDL SGWIEGMIEE LTAANNVPAQ RSSPFTADSP  120
YNNNTVEGSS TSLDSSLDTD SPSQVPPLHY QEALLDNGFS STGLPCATTS YPASSKSCSM  180
LPHQQSTDSS SETHVLPMME SRNHQRPQVN EDEQEDNGVQ LVHSLLACAE AVQHGDLVRA  240
EETVRHIQLL ASPPGPMGKV AAHFIEALTR RIYGGTSSSQ DSSSCNVVSY ESNNYLSELL  300
HFQYYETCPY LKFAHFTSNQ AILEAFEGEK RVHVIDFNLM HGLQWPALIQ ALALRPGGPP  360
SLRLTGIGPP QAGGNNGLQE IGMKLAQLAA SVNIEFDFRG VVALKLNEVK PWMLQVLPGE  420
VVAVNSVLQL HRFLNSDGGP VLAIDEVLHS ILGLKPKIVT VVEHEANHNV SGFLDRFTEA  480
LHYYSTMFDS LEACNLQPQS SEQLLAEMYL GQEICNIIAC EGVARVERHE NLEQWRQRIA  540
KAGFRPLQLG STALKQAKLL LSLFPGDGYR VEENNGCLTL GWHTRPLIAF SAWQCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-662055933378Protein SCARECROW
5b3h_A3e-662065933377Protein SCARECROW
5b3h_D3e-662065933377Protein SCARECROW
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6464700.0EF646470.1 Sphagnum palustre DELLA protein (DELLA) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361039.10.0DELLA protein GAI-like
TrEMBLA7U4T40.0A7U4T4_SPHPA; DELLA protein
STRINGPP1S12_244V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-145GRAS family protein