PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0197s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 943aa    MW: 101814 Da    PI: 6.3131
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0197s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS402.15.5e-1235809362373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             lLl+cAeavs ++ + a+++L +lsela+p+g+++qR++ayf+e++a+rl+ s+ +  + lpp +    ++++ ++a+++f++++P+
  Sphfalx0197s0015.1.p 580 LALLLQCAEAVSVNNVNDANSMLLQLSELATPYGSSVQRVVAYFAEGMASRLVASSLGFLSPLPPIQMI--TTQKIISAVQIFNDMCPL 666
                           579***************************************************99999*999999987..59999************* PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                           +kfsh+taNqaI++a+eg + vHiiD+di++GlQWpaL++ La+Rp+gpp++RiTg+g     s e le+tg+rL++fAe+l++pfe+n
  Sphfalx0197s0015.1.p 667 VKFSHFTANQAIVDAFEGMRDVHIIDIDIMHGLQWPALFHILACRPGGPPQVRITGLGT----SMELLEATGKRLSDFAETLRLPFEYN 751
                           ***********************************************************....************************** PP

                  GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           + va+r+ ++++++Lrv+ g+alaV+++   h+l+d ++s ++    +L+l+++lsPkv++vveq++ h ++sF +rf+eal+yysalf
  Sphfalx0197s0015.1.p 752 A-VADRIGNVDPSALRVRMGDALAVHWMQ--HSLYDVTGSDPQ----TLSLLRRLSPKVITVVEQNLRH-EGSFIDRFIEALHYYSALF 832
                           *.8*************************9..999988998888....**********************.899**************** PP

                  GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                           dsl a++  e+ +r+ vE++ll+ ei+n++a  g +r+ + + +++Wr+ l++aGFkpv+ls kaa+qa+lll +++ dgy++ ++ g+
  Sphfalx0197s0015.1.p 833 DSLGANYTDENLDRHLVEQQLLSCEIKNIIAVGGPARTGQPK-FMQWRDELTQAGFKPVSLSGKAATQASLLLGMFPCDGYTLIDQTGT 920
                           ************************************998887.********************************************** PP

                  GRAS 358 lvlgWkdrpLvsvSaW 373
                           l lgWkdr L+++SaW
  Sphfalx0197s0015.1.p 921 LKLGWKDRCLLTASAW 936
                           **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.863553917IPR005202Transcription factor GRAS
PfamPF035141.9E-120580936IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MALVCPNRAS EGFGSVLPTT ISSRLGLCMH NVNNSAAVHR AREFCMAENS LTAAASSHNN  60
YSSASSGRTG QDSSERGGAK QLTAASLEIS SDIQSGPGGG SGLLLATVPN LGIGAAVVGK  120
APGKLASPTP AGWLTYNSSS SVSTFPASSG REDWSMFLPP AAHIPPVLGG PLAMTSSHLF  180
SSPLSVPSQT GTSTAFSNSR EQAAAFSIRD EFHLQSLSAA SPIGMGGSMS GASCNAASSL  240
GKLMEEGSSE QQQQQSLGVA AGSNLLQYEL PHVGSSDAGG QRRDKASLPP SDHHDILQQN  300
VMDHEDTISV WVDGTITELM AAMPGVPLQH LFAKLIEVLE PCNMQLQKLI ESRFHALFGS  360
TTEEAPGWQL QKLSHAHGSP RSASQAGGHG GSSKRMRGNT NNEEDDLLNV HVNEFRSNSG  420
GGELLLRLQG KRHEQHPSSL LPQLPPPMTR DSEAFTTAIE DRSIASLQLS LDPWNQRMQE  480
HSQQQQQQQQ VSAVVEDQFH HLRALEMNLL PVQQQQEQQR QQKYHQPLPQ QQHHHHHEEQ  540
ARTTQNSSST ILHPSAAEVA HYGNQASSSV YENTQGLELL ALLLQCAEAV SVNNVNDANS  600
MLLQLSELAT PYGSSVQRVV AYFAEGMASR LVASSLGFLS PLPPIQMITT QKIISAVQIF  660
NDMCPLVKFS HFTANQAIVD AFEGMRDVHI IDIDIMHGLQ WPALFHILAC RPGGPPQVRI  720
TGLGTSMELL EATGKRLSDF AETLRLPFEY NAVADRIGNV DPSALRVRMG DALAVHWMQH  780
SLYDVTGSDP QTLSLLRRLS PKVITVVEQN LRHEGSFIDR FIEALHYYSA LFDSLGANYT  840
DENLDRHLVE QQLLSCEIKN IIAVGGPART GQPKFMQWRD ELTQAGFKPV SLSGKAATQA  900
SLLLGMFPCD GYTLIDQTGT LKLGWKDRCL LTASAWSSNA HS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-17058593725379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S882_1V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-161GRAS family protein