PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0193s0032.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 444aa    MW: 49177.3 Da    PI: 4.9211
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0193s0032.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS402.34.9e-123724401373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL+ecA+avs++d  +aq+lL  l ++ +  gd+++R+ +yft ALa+r++r  +++  +lp    ++  s+e+laa  ++++v+P
  Sphfalx0193s0032.1.p  72 LKDLLFECAQAVSQNDWGKAQQLLGVLGTRLTAPGDSVERVSSYFTAALATRISR-ATGTQVSLPLGLIHPPGSDEVLAANLALNQVTP 159
                           5789***************************************************.555555677777776679999999999****** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRp...egppslRiTgvgspesgskeeleetgerLakfAeelgv 174
                           +++f+hltaNqa+lea++ge  vHi+D+di +GlQWp+++qaLa  R+    g p+lRiTg+g+    +++ le t +rLa+fA+++++
  Sphfalx0193s0032.1.p 160 FIRFAHLTANQALLEALAGECYVHIVDLDIVHGLQWPPFMQALAdLRAdqgPGLPQLRITGIGK----DRQILEMTSRRLADFAQSINL 244
                           ********************************************76777544578*********....9******************** PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           pfef + + ++l++l++++L++++gEalaVn++lqlh ll+e        +++L ++ sl+P+vv+++e+e++ n++ Fl+rf++al++
  Sphfalx0193s0032.1.p 245 PFEFIP-LIQNLDSLKPSMLQLRTGEALAVNCMLQLHGLLEEAPVAL---ESFLGMLYSLNPRVVTLAEREMSSNQPIFLDRFADALNH 329
                           ******.5999*****************************6644333...47************************************* PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrv 351
                           ys+lfdsl+a+lp+ s+eri vE+ ++ +ei n+v ce++e+++r +++++Wr  +e+aGF+ ++ se+a +qa+lllr ++ s+gy++
  Sphfalx0193s0032.1.p 330 YSTLFDSLDATLPPSSSERIRVEQLWFWKEIANIVGCEESEHIMRYQKFHQWRIFMETAGFQLLSTSEFALSQARLLLRLHYpSEGYHL 418
                           ***************************************************************************************** PP

                  GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
                            e++g+l+lgW+d+pL++vS+W
  Sphfalx0193s0032.1.p 419 VEDDGCLLLGWRDQPLFAVSSW 440
                           ********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.01846420IPR005202Transcription factor GRAS
PfamPF035141.7E-12072440IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010223Biological Processsecondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MQSLSQLCIL SNPSLLQFQL QLPAALHEML GSVDSHVPAP SEPAEHGPSD WPSVEQIHSH  60
IDHSPSGALV QLKDLLFECA QAVSQNDWGK AQQLLGVLGT RLTAPGDSVE RVSSYFTAAL  120
ATRISRATGT QVSLPLGLIH PPGSDEVLAA NLALNQVTPF IRFAHLTANQ ALLEALAGEC  180
YVHIVDLDIV HGLQWPPFMQ ALADLRADQG PGLPQLRITG IGKDRQILEM TSRRLADFAQ  240
SINLPFEFIP LIQNLDSLKP SMLQLRTGEA LAVNCMLQLH GLLEEAPVAL ESFLGMLYSL  300
NPRVVTLAER EMSSNQPIFL DRFADALNHY STLFDSLDAT LPPSSSERIR VEQLWFWKEI  360
ANIVGCEESE HIMRYQKFHQ WRIFMETAGF QLLSTSEFAL SQARLLLRLH YPSEGYHLVE  420
DDGCLLLGWR DQPLFAVSSW NAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-707844124378Protein SCARECROW
5b3h_D1e-707844124378Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024377672.11e-178scarecrow-like protein 18
RefseqXP_024377674.11e-178scarecrow-like protein 18
RefseqXP_024377675.11e-178scarecrow-like protein 18
RefseqXP_024377676.11e-178scarecrow-like protein 18
RefseqXP_024377677.11e-178scarecrow-like protein 18
TrEMBLA0A2K1KFX51e-177A0A2K1KFX5_PHYPA; Uncharacterized protein
STRINGPP1S240_118V6.11e-178(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.14e-92GRAS family protein