PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0193s0016.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 376aa    MW: 43279.4 Da    PI: 8.7922
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0193s0016.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY492.42.4e-1501937343385
               FLO_LFY  43 aaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrk 131
                           +  r+ ++leelf++yGvr  t+ak++++Gftv+tL+ m+++eld+++++++e f+++ll GeryG+kaa+rae++ +e+e  e++r  
  Sphfalx0193s0016.1.p  19 MPRREGKTLEELFENYGVRHHTLAKMSDMGFTVNTLIRMTEQELDEVIQTMVENFHIELLFGERYGVKAAIRAEKKAIEDEA-ERQRIM 106
                           44566789**********************************************************************9966.666665 PP

               FLO_LFY 132 ll..sedeetaldalsqeglseepvqeekeaags...........................ggeglgeaelvaaeekkseeekkkaskk 191
                            +  +++++ +l+  s  +++e ++ + + ++++                           g+++lg+++l+  ++ +           
  Sphfalx0193s0016.1.p 107 SFgsKSEKKRKLEGRSLAASKEVARINDIRMNNNmllppeslgqvgpvnlnlkepsllhtqGHNSLGTVGLLDLPDDD----------- 184
                           555444555588888877766666666555555557777766665554444444444333222222223333222211........... PP

               FLO_LFY 192 kqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                                 +++++++++  +++++ ++ ++ gedge+r+rehPfiv epg++ rgkknGLDYLfdLyeqC++fL++ q+i+ke+GekcP k
  Sphfalx0193s0016.1.p 185 -----PSSDSSQHQKVGKKRQKRRQLKELGEDGEDRPREHPFIVSEPGDIVRGKKNGLDYLFDLYEQCGKFLVECQQISKEKGEKCPIK 268
                           .....1111122233333334444556799*********************************************************** PP

               FLO_LFY 281 vtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWY 369
                           vtnqvfr+ak+aga yinkPkmrhYvhCYalhcLd+e+sna+r+ +kergenvGawrqacy plv++a+ +gwdi+++fn+++rL+iWY
  Sphfalx0193s0016.1.p 269 VTNQVFRHAKHAGAGYINKPKMRHYVHCYALHCLDTEQSNAIRKVYKERGENVGAWRQACYWPLVSMARANGWDIEGLFNRNERLKIWY 357
                           ***************************************************************************************** PP

               FLO_LFY 370 vPtkLrqLChlerska 385
                           vPtkLrqLCh er+k+
  Sphfalx0193s0016.1.p 358 VPTKLRQLCHFERTKH 373
                           *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.5E-12420373IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDTMTHKDNP LAYEFFTGMP RREGKTLEEL FENYGVRHHT LAKMSDMGFT VNTLIRMTEQ  60
ELDEVIQTMV ENFHIELLFG ERYGVKAAIR AEKKAIEDEA ERQRIMSFGS KSEKKRKLEG  120
RSLAASKEVA RINDIRMNNN MLLPPESLGQ VGPVNLNLKE PSLLHTQGHN SLGTVGLLDL  180
PDDDPSSDSS QHQKVGKKRQ KRRQLKELGE DGEDRPREHP FIVSEPGDIV RGKKNGLDYL  240
FDLYEQCGKF LVECQQISKE KGEKCPIKVT NQVFRHAKHA GAGYINKPKM RHYVHCYALH  300
CLDTEQSNAI RKVYKERGEN VGAWRQACYW PLVSMARANG WDIEGLFNRN ERLKIWYVPT  360
KLRQLCHFER TKHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A6e-992073744171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B6e-992073744171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196203KKRQKRRQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978027.11e-139floricaula/leafy-like protein FL1
SwissprotO044071e-156NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLQ9LLB51e-164Q9LLB5_SCEDI; BotdiFLO protein
STRINGEFJ206841e-138(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-86floral meristem identity control protein LEAFY (LFY)