PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0183s0036.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 966aa    MW: 105167 Da    PI: 5.0937
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0183s0036.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.66.4e-985008971347
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal........ 81 
                           lv+ Ll+cAea+++ d++ a+alL rl+ ++sp+gdpm+R+a+yf+eAL +rl+++  + +++ ++s++++++ ++++++         
  Sphfalx0183s0036.1.p 500 LVHFLLACAEAMDACDFHIARALLIRLRANSSPHGDPMKRIAFYFAEALGERLTKELVQDCATRRSSRSTSSKLQNTITSGaaataaap 588
                           6899***************************************************554444444444444445444444436778999* PP

                  GRAS  82 ...................klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgv 147
                                              ++ +e+ P+ kf+h+t NqaIle + ++ ++Hi+D+di qGlQWp L+qaLa R+    ++p  lRiT++
  Sphfalx0183s0036.1.p 589 ptavasassrpvldsdlayQASYEILPFEKFAHFTGNQAILETLLHHPKLHIVDLDIRQGLQWPGLIQALAVRKlggsSPPSLLRITAI 677
                           ***************999999****************************************************99884445589***** PP

                  GRAS 148 gspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll..................desv 218
                           g     ++ +l++tg+rLa fA++l+vpfe+ v v ++le+l+ +++rv+ +E laVn++  lh+ll                  de+v
  Sphfalx0183s0036.1.p 678 GL----DASALHRTGKRLAAFAASLQVPFEYCV-VLESLENLQARNIRVEADEILAVNCSSVLHTLLscscksapevdsrrssaeDEDV 761
                           **....9*************************9.799****************************************998655333333 PP

                  GRAS 219 sleserdevL.klvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak..........lpreseerikvErellgreivn 296
                                ++++L ++++ l+P +v + e ea++n+++Fl+rf+eal+yy alfd+lea+           + +se r  +E++l +++i++
  Sphfalx0183s0036.1.p 762 ----VIQSFLsNTIRALNPAIVSLLETEANLNAPKFLTRFVEALHYYCALFDALEATttaaacdggaRHMDSERRLQIEKFLYAPQIRD 846
                           ....446698458*****************************************888789999888766678***************** PP

                  GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                           ++a+eg++rr rh + + W + +++aGF++ p+s +aa+qa+ll+r ++++
  Sphfalx0183s0036.1.p 847 IIAHEGTDRRVRHVRSGAWTSYFTQAGFRSSPMSAYAADQAQLLVRLYQQQ 897
                           ************************************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.124474904IPR005202Transcription factor GRAS
PfamPF035142.2E-95500897IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 966 aa     Download sequence    Send to blast
MEEQVAWMQQ QQQQEGAWVR RRKRRRRFRN SSDAAAGDDL LLLPLQWQLE DSSLLQQQQQ  60
LVHLDCNNYE HTCRKQQVDW PSAAAAASTP PVQSLQLEYS SYGASSCCSS SNSWPSYYKD  120
HLLLQAPTKL PWSSCNNKKV TVLEAAVVDD FHTFMEPTSV LDLQQQSITT TSRPSRSYSS  180
ASLSSQHSFS SSDAGSNPQR IQHAEPPPAA ATAADDDDDL HFVAPAQLAD QNQLLLPTVC  240
VSDSDIASWM DCMMDPNLAL LLPEFQAAEV ESSGGAAAAG DSELMMMAAG CSPRPAISKL  300
EGNHNTADMQ FSGTEIEFEF ETSLDKSFNG SCGAAQLSSF PNFFPVASTG MMMMQCDDVE  360
MQQQQQQQQE PAMESAVAAA GVCLWEDEAP MFLVPGQILS HEVCLVPSES NLQLQQKPLQ  420
RRLTNTRAAA PVFSSQGQQL LPHSSTRDAA ARSAARSCAA SPAVQSPPPQ AVGAGHAEKL  480
RLWQQQKQQQ DEEENTGLDL VHFLLACAEA MDACDFHIAR ALLIRLRANS SPHGDPMKRI  540
AFYFAEALGE RLTKELVQDC ATRRSSRSTS SKLQNTITSG AAATAAAPPT AVASASSRPV  600
LDSDLAYQAS YEILPFEKFA HFTGNQAILE TLLHHPKLHI VDLDIRQGLQ WPGLIQALAV  660
RKLGGSSPPS LLRITAIGLD ASALHRTGKR LAAFAASLQV PFEYCVVLES LENLQARNIR  720
VEADEILAVN CSSVLHTLLS CSCKSAPEVD SRRSSAEDED VVIQSFLSNT IRALNPAIVS  780
LLETEANLNA PKFLTRFVEA LHYYCALFDA LEATTTAAAC DGGARHMDSE RRLQIEKFLY  840
APQIRDIIAH EGTDRRVRHV RSGAWTSYFT QAGFRSSPMS AYAADQAQLL VRLYQQQQTS  900
RSSLSSSSSF SSSSSSSCSS SAAPDDDNMQ QPYKLTTGSN TTPPGAITLG WQDTPVITVS  960
SWTLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-524869637378Protein SCARECROW
5b3h_D7e-524869637378Protein SCARECROW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12026RRKRRRR
22125RKRRR
32128RKRRRRFR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-54RGA-like 2