PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0167s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 637aa    MW: 70471 Da    PI: 5.1787
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0167s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.57.9e-1022226103374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cA+a++++d+ ++q+l++ l+elasp+gd  qRla+y+++AL  r+++++ ++ ++l + ++++++ ++  ++  +f+e+sP+ 
  Sphfalx0167s0042.1.p 222 NLLLDCARAIAESDTLRVQNLMWVLNELASPYGDCDQRLATYLLQALFCRVMGTGAQCHSTLCAAAEQSYSFESLRNMILTFQEASPWT 310
                           69**********************************************************998888877777777777778******** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg.skeeleetgerLakfAeelgvpfef 178
                           +f+h++aN +++ea+ege  +Hi+D++ + ++QWp+Ll+aLa+R eg+p  lR+T+++ ++++   + ++++  rL++fA+ +gvpfe 
  Sphfalx0167s0042.1.p 311 TFGHVAANGTMMEAFEGEMNIHIVDISSTFCTQWPTLLEALATRVEGTPnLLRLTTIVLSKEEsAMKVMRQIMTRLERFARLMGVPFES 399
                           *********************************************8888689*****9987777999********************** PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrll................desvsleserdevLklvkslsPkvvvvveqeadhnse 251
                           +++  ++le+lel eL+++++Eala+n+++ lh++                 ++  s+ s+rd vL+++k+ +Pk++++ve e+d+ s+
  Sphfalx0167s0042.1.p 400 TLMQKSQLETLELAELNLRQDEALAINCIHTLHHVSesttalitpdtraaaaAQCNSTISPRDLVLHTFKNANPKIITIVEDEVDLVSS 488
                           **8888*******************************************99988888899***************************** PP

                  GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqakl 339
                           +F+++f+eal+yy  lf+sle+++pr+s+er ++Er   +r+  n++ac  ++  +er+e+ ++W  rl++ G+ p+p+s+++++++++
  Sphfalx0167s0042.1.p 489 NFMTGFSEALRYYFILFESLEESFPRASNERLMLERT-CARKMINLLACDDSSqIEERQESGSQWATRLQRLGLLPAPFSDDVVDDVHA 576
                           *************************************.6777779999988872568999***************************** PP

                  GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ll+++k dg+ +++++  l+l+Wkd++++++S+W+
  Sphfalx0167s0042.1.p 577 LLKRYK-DGWGLKSHDSRLFLTWKDQAIIFASSWK 610
                           ******.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.442194591IPR005202Transcription factor GRAS
PfamPF035142.7E-99222610IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MDKFFPKLVE YPSAFHDQVT NLNSGHGAAS SSSPPGHSDD PRDNFDSTTR RCTTITPGAD  60
PNLIQHNGHL VLGFMPQQRT AAVGVGPSCY ASDLHASTCS EGSEFPHLRS DDSGGHEMNP  120
ALFRLGESFE LGSQALRRSA AQINLWHDNQ GGYQAGHEQW DQESSPQEHA TGKPELILTD  180
YANFCDQIVG LQRNRSRHLS SSTTTLGGTS DQIGTTNHWA PNLLLDCARA IAESDTLRVQ  240
NLMWVLNELA SPYGDCDQRL ATYLLQALFC RVMGTGAQCH STLCAAAEQS YSFESLRNMI  300
LTFQEASPWT TFGHVAANGT MMEAFEGEMN IHIVDISSTF CTQWPTLLEA LATRVEGTPN  360
LLRLTTIVLS KEESAMKVMR QIMTRLERFA RLMGVPFEST LMQKSQLETL ELAELNLRQD  420
EALAINCIHT LHHVSESTTA LITPDTRAAA AAQCNSTISP RDLVLHTFKN ANPKIITIVE  480
DEVDLVSSNF MTGFSEALRY YFILFESLEE SFPRASNERL MLERTCARKM INLLACDDSS  540
QIEERQESGS QWATRLQRLG LLPAPFSDDV VDDVHALLKR YKDGWGLKSH DSRLFLTWKD  600
QAIIFASSWK PNPAAAARNR AAATTEGAAP PDEFYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B1e-12721961132420Protein SHORT-ROOT
5b3h_E1e-12721961132420Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379763.10.0protein SHORT-ROOT-like
TrEMBLA0A2K1KCY70.0A0A2K1KCY7_PHYPA; Uncharacterized protein
STRINGPP1S97_39V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-128GRAS family protein