PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0121s0036.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LBD
Protein Properties Length: 234aa    MW: 25889.7 Da    PI: 8.3983
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0121s0036.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42521511100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da+sslvyeA+ar+rdPvyG++gvi +lqqq++ 
  Sphfalx0121s0036.1.p  52 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMDVPENQRADAVSSLVYEANARIRDPVYGCMGVIYALQQQIRL 140
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ael+++++ 
  Sphfalx0121s0036.1.p 141 LQAELSAVRKD 151
                           ******99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09651152IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4252149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MLQKSRDREP ERTGILLKKL HCRKKAEKKK KIGFLIGFCF LLMALATNAC TPCAACKLLR  60
RRCAQECPFS PYFSPHEPQK FASVHKVFGA SNVSKMLMDV PENQRADAVS SLVYEANARI  120
RDPVYGCMGV IYALQQQIRL LQAELSAVRK DILRYKTTHQ QETTILPVSA SSQHSPAATA  180
AELDNPTTSS PAAAELLFPT ADSTPHASVD QSDPEDVHTP ESKEHTYWDS TLT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11730KKLHCRKKAEKKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369256.12e-65PREDICTED: LOB domain-containing protein 15-like
RefseqXP_002520837.12e-65PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-59LBD13_ARATH; LOB domain-containing protein 13
TrEMBLB9S4B82e-65B9S4B8_RICCO; LOB domain-containing protein, putative
STRINGVIT_13s0067g02380.t012e-64(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-60LOB domain-containing protein 13