PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0105s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 1141aa    MW: 123069 Da    PI: 6.2803
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0105s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.14.2e-9473210392300
                  GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn............... 73  
                              lLl+cAea+s+++  +a+++L +l+ la+p+g+++qR++ayf+e++a+rl  s  +++++ ++s +s++                
  Sphfalx0105s0005.1.p  732 LALLLQCAEAMSAENVDEANSILPQLNALATPYGSSVQRVVAYFAEGMASRLITSFLGISSSSSSSWSSSSPvpllqlwpgmimqsl 818 
                            579*********************************************************999888888666788889988888888 PP

                  GRAS   74 ...sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgske 156 
                               +++ ++a+++f+e++P++kfsh+taNqaI++a+eg + vHiiD+di+qGlQWpaL++ La+Rp+gpp  +RiTg+gs    s e
  Sphfalx0105s0005.1.p  819 ncnQKKIMSAVQVFNEICPFVKFSHFTANQAIVDAFEGMRDVHIIDIDIMQGLQWPALFHILAARPGGPPqVIRITGLGS----SIE 901 
                            8877777788899*****************************************************9988689*******....9** PP

                  GRAS  157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243 
                            +l++tg+rL++fA++lg++fe+ + va+r+ ++++++L+v++g+alaV+++   h+l+d +++ ++    +L+l+k+lsP+v+++ve
  Sphfalx0105s0005.1.p  902 SLQATGKRLSDFAQTLGLRFEYIA-VADRIGNVDPSALQVRNGDALAVHWMQ--HSLYDVTGDDPQ----TLNLLKRLSPNVITMVE 981 
                            ************************.8*************************9..999988888888....***************** PP

                  GRAS  244 qe.adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300 
                            q+ + h ++sF +rf++al+yysalfdsl a+++ es er++vE++l++ ei+n+++ 
  Sphfalx0105s0005.1.p  982 QDlLVHHDGSFINRFVDALHYYSALFDSLGASYGDESPERHVVEQQLFSCEIKNILSV 1039
                            **54569************************************************975 PP

2GRAS51.32.2e-1610771137312373
                  GRAS  312 lekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                            +++W++ l++aGFk v+ls+kaa+qa lll ++  dgy++ e+ g+l lgWkd  L+++SaW
  Sphfalx0105s0005.1.p 1077 VRQWKDELSQAGFKRVSLSHKAATQAALLLGMFR-DGYTLLEQIGTLKLGWKDLCLLTASAW 1137
                            68********************************.*************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.5027051119IPR005202Transcription factor GRAS
PfamPF035141.5E-917321039IPR005202Transcription factor GRAS
PfamPF035147.7E-1410771137IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1141 aa     Download sequence    Send to blast
MALVCPSLPA TDLERSLGSV SAVLTTSCCT SQVPAGSICC CTHHLITTPY SVQETAAREF  60
CMAEDSLQTA VNSYHMSCSS SASGGETIQD PSHESQVVTG AALKTLVQQQ EHHRATVAAV  120
SGLLATSVPA AKWARTAASA PRDAFAYRSS TPLNLVAEWP AGFSSGSPSS TSFAPFSAGD  180
HCSMFPQPAA AAAEIDPSRS FHAYVGGWSS AAMTSASPHL WSSPLSTPSQ TGNSSSAFSN  240
FTRGQAHAAA SSLQNLQIYQ ADSSTYPKTE LVGSRFAAAA ASCCDTPASE LKLDYGSDPQ  300
QQFLTGQYAN AQDQQYRGEI LPCAAHGFTV DHYAGLQAGD PVRAAQLSNL SVSEQNHRVM  360
NSEDIVFACV DRTITELMTA MPAAEPGATA PDLQHLFAKL LEVLQPSSIQ LVRLIEARFH  420
AIFFGNTEGI KLKVMKLSDA STTASVPLAA GASTSKTTAS SSKRMRDQLN TSSDSSLNGR  480
AEYDLHEEDP RSVFHLHTRL DQHRRPLQQA VTKASSSRHP LKRRIVSNSQ LATDTADRLQ  540
IESSSRLVPP LRESPPPVME QRDSSVKFAK ATLEEAHRSL ASSEPSFDLR GNLEVMREHS  600
ITQQQQQEQV SAAAAVQDQF HHMKALEMSS QQPYDQLQPP QQYQHHLQLE QAARTSQNFC  660
NTLQYASAVQ PHYGCNLEAL GYEDSQQQQQ VQYDHGQPLK PSATEPASGS CSSILHADRI  720
INAYDEKGFE LLALLLQCAE AMSAENVDEA NSILPQLNAL ATPYGSSVQR VVAYFAEGMA  780
SRLITSFLGI SSSSSSSWSS SSPVPLLQLW PGMIMQSLNC NQKKIMSAVQ VFNEICPFVK  840
FSHFTANQAI VDAFEGMRDV HIIDIDIMQG LQWPALFHIL AARPGGPPQV IRITGLGSSI  900
ESLQATGKRL SDFAQTLGLR FEYIAVADRI GNVDPSALQV RNGDALAVHW MQHSLYDVTG  960
DDPQTLNLLK RLSPNVITMV EQDLLVHHDG SFINRFVDAL HYYSALFDSL GASYGDESPE  1020
RHVVEQQLFS CEIKNILSVG AGTSLAAAAA AAASSSRGCS GTAAATDHGV RPHVKFVRQW  1080
KDELSQAGFK RVSLSHKAAT QAALLLGMFR DGYTLLEQIG TLKLGWKDLC LLTASAWSCN  1140
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-147725113813379Protein SCARECROW
5b3h_A1e-148725113812378Protein SCARECROW
5b3h_D1e-148725113812378Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-142GRAS family protein