PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0083s0036.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 480aa    MW: 52872.9 Da    PI: 4.673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0083s0036.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.31.5e-100714763374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLlecA av+++d+++aq+l++ l+elasp+gd  qRla+yf++AL  ++++++ ++y++l + ++++++ +++ ++   f+e+sP+ 
  Sphfalx0083s0036.2.p  71 NLLLECAMAVAANDTSQAQKLMSVLNELASPYGDCDQRLASYFLQALFCKITNTGLRCYRILLAAAEKSYTFESVRKMILEFQEASPWT 159
                           69************************************************************9999987776666667677******** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfe 177
                           +f+h+++N aIlea+ege +vH++D++ + ++QWp+Ll+aLa+R+eg+p+lR+ +++ + +      + ++++  rL +fA+ +gvpfe
  Sphfalx0083s0036.2.p 160 TFGHVACNGAILEAFEGEMKVHVVDISSTFCTQWPTLLEALATRSEGSPNLRLSAIVISPEAepaAMHVMQQIMTRLDRFARLMGVPFE 248
                           *******************************************************9864433578999********************* PP

                  GRAS 178 fnvlvakrledl...eleeLrvkpgEalaVnlvlqlhrll...............................desvsleserdevLklvk 232
                           +++    +le+l   + ++L+++++Eala+n+++ l +++                               +++  ++  rd++L +++
  Sphfalx0083s0036.2.p 249 YSLTQLPQLEQLefaQGSALELREDEALAINCIHTLNQVMpaaataedvitsaaarvltaaagdnnaaaaaAHQYGSS-SRDQILYTFR 336
                           **97444666662227788***********************************************999753333333.59******** PP

                  GRAS 233 slsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                           + +Pk+v++ve e+++ s++F++ f+eal++y+ lf sl++++pr+s+er ++Er+  +r+ivn++ace a+rr   ++   W +rl++
  Sphfalx0083s0036.2.p 337 NANPKIVTIVEDEMELVSADFMTCFSEALRFYWLLFQSLDESFPRASNERLMLERA-HARNIVNLLACEAADRRRWPQQGVDWARRLSA 424
                           ********************************************************.9******************************* PP

                  GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           a F   ++s++++ ++++ll ++k +g+ +  +++ l+l+Wkd+p++ +SaWr
  Sphfalx0083s0036.2.p 425 ASFVHSAFSDDVVGDVRALLTRYK-EGWGLITDENGLYLTWKDQPVICTSAWR 476
                           ************************.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.76343457IPR005202Transcription factor GRAS
PfamPF035145.2E-9871476IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MRPRDQRPSA PAYPTHGTSQ AAVDEGGVET GRIEELRLIS ASPAIGVATA AASYRDIDEE  60
LPSSSGHWAP NLLLECAMAV AANDTSQAQK LMSVLNELAS PYGDCDQRLA SYFLQALFCK  120
ITNTGLRCYR ILLAAAEKSY TFESVRKMIL EFQEASPWTT FGHVACNGAI LEAFEGEMKV  180
HVVDISSTFC TQWPTLLEAL ATRSEGSPNL RLSAIVISPE AEPAAMHVMQ QIMTRLDRFA  240
RLMGVPFEYS LTQLPQLEQL EFAQGSALEL REDEALAINC IHTLNQVMPA AATAEDVITS  300
AAARVLTAAA GDNNAAAAAA HQYGSSSRDQ ILYTFRNANP KIVTIVEDEM ELVSADFMTC  360
FSEALRFYWL LFQSLDESFP RASNERLMLE RAHARNIVNL LACEAADRRR WPQQGVDWAR  420
RLSAASFVHS AFSDDVVGDV RALLTRYKEG WGLITDENGL YLTWKDQPVI CTSAWRLDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B1e-1266347627419Protein SHORT-ROOT
5b3h_E1e-1266347627419Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379763.11e-171protein SHORT-ROOT-like
TrEMBLA0A2K1KCY71e-170A0A2K1KCY7_PHYPA; Uncharacterized protein
STRINGPP1S97_39V6.11e-171(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-127GRAS family protein