PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0083s0036.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 481aa    MW: 53001 Da    PI: 4.673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0083s0036.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.41.1e-99714773374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPi 90 
                           +lLlecA av+++d+++aq+l++ l+elasp+gd  qRla+yf++AL  ++++++ ++y++l + ++++++ +s + ++l++ +e+sP+
  Sphfalx0083s0036.1.p  71 NLLLECAMAVAANDTSQAQKLMSVLNELASPYGDCDQRLASYFLQALFCKITNTGLRCYRILLAAAEKSYTfESVRKMILEFQQEASPW 159
                           69************************************************************7777777776888888999999***** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                            +f+h+++N aIlea+ege +vH++D++ + ++QWp+Ll+aLa+R+eg+p+lR+ +++ + +      + ++++  rL +fA+ +gvpf
  Sphfalx0083s0036.1.p 160 TTFGHVACNGAILEAFEGEMKVHVVDISSTFCTQWPTLLEALATRSEGSPNLRLSAIVISPEAepaAMHVMQQIMTRLDRFARLMGVPF 248
                           ********************************************************9864433578999******************** PP

                  GRAS 177 efnvlvakrledl...eleeLrvkpgEalaVnlvlqlhrll...............................desvsleserdevLklv 231
                           e+++    +le+l   + ++L+++++Eala+n+++ l +++                               +++  ++  rd++L ++
  Sphfalx0083s0036.1.p 249 EYSLTQLPQLEQLefaQGSALELREDEALAINCIHTLNQVMpaaataedvitsaaarvltaaagdnnaaaaaAHQYGSS-SRDQILYTF 336
                           ***97444666662227788***********************************************999753333333.59******* PP

                  GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                           ++ +Pk+v++ve e+++ s++F++ f+eal++y+ lf sl++++pr+s+er ++Er+  +r+ivn++ace a+rr   ++   W +rl+
  Sphfalx0083s0036.1.p 337 RNANPKIVTIVEDEMELVSADFMTCFSEALRFYWLLFQSLDESFPRASNERLMLERA-HARNIVNLLACEAADRRRWPQQGVDWARRLS 424
                           *********************************************************.9****************************** PP

                  GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           +a F   ++s++++ ++++ll ++k +g+ +  +++ l+l+Wkd+p++ +SaWr
  Sphfalx0083s0036.1.p 425 AASFVHSAFSDDVVGDVRALLTRYK-EGWGLITDENGLYLTWKDQPVICTSAWR 477
                           *************************.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.11843458IPR005202Transcription factor GRAS
PfamPF035143.9E-9771477IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MRPRDQRPSA PAYPTHGTSQ AAVDEGGVET GRIEELRLIS ASPAIGVATA AASYRDIDEE  60
LPSSSGHWAP NLLLECAMAV AANDTSQAQK LMSVLNELAS PYGDCDQRLA SYFLQALFCK  120
ITNTGLRCYR ILLAAAEKSY TFESVRKMIL EFQQEASPWT TFGHVACNGA ILEAFEGEMK  180
VHVVDISSTF CTQWPTLLEA LATRSEGSPN LRLSAIVISP EAEPAAMHVM QQIMTRLDRF  240
ARLMGVPFEY SLTQLPQLEQ LEFAQGSALE LREDEALAIN CIHTLNQVMP AAATAEDVIT  300
SAAARVLTAA AGDNNAAAAA AHQYGSSSRD QILYTFRNAN PKIVTIVEDE MELVSADFMT  360
CFSEALRFYW LLFQSLDESF PRASNERLML ERAHARNIVN LLACEAADRR RWPQQGVDWA  420
RRLSAASFVH SAFSDDVVGD VRALLTRYKE GWGLITDENG LYLTWKDQPV ICTSAWRLDL  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B1e-1246347727419Protein SHORT-ROOT
5b3h_E1e-1246347727419Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379763.11e-169protein SHORT-ROOT-like
TrEMBLA0A2K1KCY71e-168A0A2K1KCY7_PHYPA; Uncharacterized protein
STRINGPP1S97_39V6.11e-169(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-125GRAS family protein