PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0074s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 664aa    MW: 72843.5 Da    PI: 5.2703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0074s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS460.31.1e-1402916622373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++c eav+++dl la+ l+a+l++ +s +g+pmqRlaay++e+L ar+a+++++lykal+++e++   +++ l+a+++ +ev+P+
  Sphfalx0074s0039.1.p 291 EQLLVACGEAVANNDLPLANVLIAQLHQVVSIYGNPMQRLAAYMMEGLIARIASTGKGLYKALRCKEAP---TADLLSAMQIMYEVCPY 376
                           689*****************************************************************9...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgv 174
                           +kf++++aN aI ea+++e+rvHiiDf+i qG+QW++L+qaLa+Rp+gpp+lRiTgv++p+sg      +  +e +g+rL+++A+++gv
  Sphfalx0074s0039.1.p 377 FKFGYMAANGAIAEAFQNEQRVHIIDFEIAQGGQWMTLIQALAARPGGPPHLRITGVDDPASGfsgmsPTGGVELVGKRLRNLAQAVGV 465
                           *************************************************************9999999999****************** PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           pf f++ vak+ ++++ ++L+ +pgEalaVn++lqlh+++desv+++++rd++L++vksl+Pkvv++ve+ea++n+++F+ rf+e+l+y
  Sphfalx0074s0039.1.p 466 PFVFHP-VAKNGTQVQEWMLERQPGEALAVNFALQLHHMPDESVCTTNPRDRILRMVKSLQPKVVTLVEHEANTNTAPFFPRFMETLSY 553
                           ******.7********************************************************************************* PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           ysa+f+sl+ +l+res++r+kvE+ +l+r+ivnv+aceg+er+er e l+kW++r+++aGF+p+pls++++ ++k+ll+ +++  yr++
  Sphfalx0074s0039.1.p 554 YSAIFESLDITLARESQDRVKVEQNCLARDIVNVIACEGSERVERYELLGKWKARMTMAGFQPYPLSSSVNRTIKTLLESYSD-KYRLK 641
                           **********************************************************************************5.5**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaW 373
                           ee ++l+lgW++rpLv++SaW
  Sphfalx0074s0039.1.p 642 EEGAALILGWMNRPLVVASAW 662
                           ********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.05264644IPR005202Transcription factor GRAS
PfamPF035144.0E-138291662IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MSVQYRPDFK GGGSSSRESV YLQDTANSQQ VVPGYYPAKQ AYTDKAQQRQ AHVQYELQHQ  60
MKNQQGSPIS PLSPPESSQA ASDIAPSSGQ GWSPVSFHSE TSFRSEVSLE SKFHTHEDAE  120
FYGQPNGELS SHHSTSSSLA MLAPTSSQST VTTHSSFNTT TYNLAARNHV AEQQYAQQAH  180
SGYAKKEMRS DVAHMLQILE NALLDDNDDE DETDLAASLS QSRNTLSADG GWVDTLEELL  240
AVERSSPLDS QSHEVSATSA ASAQSPSSSD TYSTAVPEDV ETVMDTRSQS EQLLVACGEA  300
VANNDLPLAN VLIAQLHQVV SIYGNPMQRL AAYMMEGLIA RIASTGKGLY KALRCKEAPT  360
ADLLSAMQIM YEVCPYFKFG YMAANGAIAE AFQNEQRVHI IDFEIAQGGQ WMTLIQALAA  420
RPGGPPHLRI TGVDDPASGF SGMSPTGGVE LVGKRLRNLA QAVGVPFVFH PVAKNGTQVQ  480
EWMLERQPGE ALAVNFALQL HHMPDESVCT TNPRDRILRM VKSLQPKVVT LVEHEANTNT  540
APFFPRFMET LSYYSAIFES LDITLARESQ DRVKVEQNCL ARDIVNVIAC EGSERVERYE  600
LLGKWKARMT MAGFQPYPLS SSVNRTIKTL LESYSDKYRL KEEGAALILG WMNRPLVVAS  660
AWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-672926636375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379851.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379861.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379870.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379876.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379885.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379891.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379899.10.0scarecrow-like transcription factor PAT1
SwissprotQ8GVE11e-173CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A2K1L6M10.0A0A2K1L6M1_PHYPA; Uncharacterized protein
STRINGPP1S346_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-169scarecrow-like 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]