PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0073s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 731aa    MW: 80598.3 Da    PI: 5.6673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0073s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.43.6e-1393477291373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cAeav ++d+++a+al+++l++ +s  gdpmqRlaay++e+L a++++s+ ++y++l+++e     + + l+a++++++v+P
  Sphfalx0073s0050.1.p 347 LERLLVACAEAVGENDFTQASALITTLKQVVSIVGDPMQRLAAYMVEGLVAKMVSSGGNIYRTLKCKEPL---VGDFLSAMQVLYQVCP 432
                           5789*****************************************************************8...9*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...............skeeleetge 163
                           ++kf++++aN aI ea+++eervHi+Df+i+qG+QW +L+qaLa+Rp+gpp+lRiTgv++p s+                   le++g+
  Sphfalx0073s0050.1.p 433 YFKFGYMAANGAIAEAFQNEERVHIVDFEINQGVQWCTLIQALAERPGGPPHLRITGVEDPPSSssefmsthpttgaggGGGGLESVGD 521
                           ***********************************************************998778999****99999999999****** PP

                  GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                           rL+k+A+++gvpf f++ v+k+  +++ ++L+ ++gEalaVn++lqlh+++desv++ ++rd++L++vk+l+Pkvv++veqea++n+++
  Sphfalx0073s0050.1.p 522 RLRKLAQSVGVPFVFHA-VEKKGPEVQAWMLERQHGEALAVNFALQLHHMPDESVCMMNPRDRLLQMVKGLNPKVVTIVEQEANTNTAP 609
                           *****************.7********************************************************************** PP

                  GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                           Fl rf+ea++yysa+f sl+ +lpres++ri+vE+++l+r+ivnv+acegaer+erhe l+kWr+r+++aGF+p +ls++++ ++klll
  Sphfalx0073s0050.1.p 610 FLPRFIEAMNYYSAVFQSLDITLPRESRDRINVEQQCLARDIVNVIACEGAERVERHEMLGKWRSRMTMAGFRPHHLSSTVNHTIKLLL 698
                           ***************************************************************************************** PP

                  GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           + ++++ y+++ee+g+l+lgW++r+L+++SaW
  Sphfalx0073s0050.1.p 699 KAYSNN-YKLKEEEGALFLGWMNRSLIVASAW 729
                           ****66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.815321711IPR005202Transcription factor GRAS
PfamPF035141.2E-136347729IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MMQYRPELGS TIGLTPQYPT ERRDRDYYFT TDIANNSRQI SSYYTTTATT RQAFEDAQRV  60
ETAHYASLPR PKDHRLSVSI LLPPNSTAAA TALEAAVAAV PNLQRSWSPE SSQSKEASES  120
AGSDGSLESN ETDLFDAHPF HHSGDQPTLS SSLHNPPASS SSMRPVAVSN SSSAAVAAAV  180
ESYQMMNFEP SRNHHHHHHH HYTPEKQYEM SGEVTQMLQD LESALLEDDD DDNLPSSFYQ  240
QHCGITTTSE RSFWADAAFG VDMLHDAVPE NTTSVPLESR LMPLQIPLST SGAAVQQSAS  300
DATDQQRQHH NHPPVRSVES LPDAPNTVGI EDSAQPGVEV PPETRRLERL LVACAEAVGE  360
NDFTQASALI TTLKQVVSIV GDPMQRLAAY MVEGLVAKMV SSGGNIYRTL KCKEPLVGDF  420
LSAMQVLYQV CPYFKFGYMA ANGAIAEAFQ NEERVHIVDF EINQGVQWCT LIQALAERPG  480
GPPHLRITGV EDPPSSSSEF MSTHPTTGAG GGGGGLESVG DRLRKLAQSV GVPFVFHAVE  540
KKGPEVQAWM LERQHGEALA VNFALQLHHM PDESVCMMNP RDRLLQMVKG LNPKVVTIVE  600
QEANTNTAPF LPRFIEAMNY YSAVFQSLDI TLPRESRDRI NVEQQCLARD IVNVIACEGA  660
ERVERHEMLG KWRSRMTMAG FRPHHLSSTV NHTIKLLLKA YSNNYKLKEE EGALFLGWMN  720
RSLIVASAWH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6235472926378Protein SCARECROW
5b3h_A3e-6235472925377Protein SCARECROW
5b3h_D3e-6235472925377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379851.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379861.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379870.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379876.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379885.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379891.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379899.10.0scarecrow-like transcription factor PAT1
SwissprotQ8GVE11e-161CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
SwissprotQ9LDL71e-162PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A2K1L6M10.0A0A2K1L6M1_PHYPA; Uncharacterized protein
STRINGPP1S346_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-159GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]
  6. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]