PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0070s0083.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 256aa    MW: 28352.5 Da    PI: 8.2926
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0070s0083.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY41.42.4e-1314821742114
               FLO_LFY  42 aaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavr 114
                           +  a  + +le +f+++Gvr  t+aki+elGft +t++    +el  l +s+ +  ++ l vGe +Gik a +
  Sphfalx0070s0083.1.p 148 SGPAAPATDLETFFEGFGVREETIAKIKELGFTGKTFMSNL-DELPLLFESIKQ--HCHLTVGEEWGIKGAAK 217
                           222333669****************************9866.58999****998..67899********9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.8E-7155217IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVKVKGVEWN HVVVLKEPEK HGMATLVKCA HCQKEFQGNA MRIRAHLLGN KRSAGVSGCP  60
SCPEDAREEL RIVDQAKSLT KRKREARRGI RPSSATFENG TDNGLQQMEL MASLQKGEKT  120
QMEQAFRNMV FQTGAVPVNF VSVSPFKSGP AAPATDLETF FEGFGVREET IAKIKELGFT  180
GKTFMSNLDE LPLLFESIKQ HCHLTVGEEW GIKGAAKKWQ KDYSLVFAQP DGEKWQEPEN  240
GALNGCKELL CLPQS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369664.11e-131uncharacterized protein LOC112279448
TrEMBLA0A2K1KTT21e-130A0A2K1KTT2_PHYPA; Uncharacterized protein
STRINGPP1S140_156V6.11e-102(Physcomitrella patens)