PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0067s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 772aa    MW: 85070.4 Da    PI: 6.1185
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0067s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.85.1e-1013987682374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL+ cAeav+++d ++a++++a+l+ l sp+g+  qR+a+yft AL a++++++ +l++al++++ s    ++ l a+k f+   P+
  Sphfalx0067s0082.1.p 398 TNLLIICAEAVKQNDVRNASRIIAELRALTSPSGNGAQRMAHYFTDALVAKMSGTGAQLSAALRSNAPS---PATMLRAYKSFVLHAPY 483
                           689************************************************************999999...799999*********** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                           ++++h+  N aIl+a++g++rvH + +++++G+ +++L+q+LasRp+g+p+lRiTg+++++      +e l + g+rL+++A++ +vpf
  Sphfalx0067s0082.1.p 484 FTLTHFNINVAILNAFKGATRVHLVAYGLTYGGLFLTLIQQLASRPGGAPNLRITGIEHARDItckPSELLIRCGQRLSEVAKTYEVPF 572
                           ***********************************************************87769999999******************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ++++ +a+++e+++  +L+++p+E+laVn +++l ++ldesv ++++r+ +L+ ++s++Pkv+  +   a++n++ F+ r+ ea++yys
  Sphfalx0067s0082.1.p 573 QYTA-IANKWENITATQLALRPDEVLAVNASFKLSNFLDESVMVTNPRQMFLNKIRSMNPKVFLTSLGSASLNEPFFMSRVREAIKYYS 660
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                             fd+l++ +p++ + r  +E+e++ +ei n++aceg er+ r e++++W++r+++aGF + pl+ ++++++k++lr ++++ + +  +
  Sphfalx0067s0082.1.p 661 IQFDTLDVVMPPNLKGRLLIEKEVFFQEILNIIACEGLERVDRPESYKQWHSRIQRAGFVQKPLQLSETNTIKSILRSYDKR-FGIGRD 748
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                            ++++ gW++++++++S W+
  Sphfalx0067s0082.1.p 749 GDWFLSGWRNQAMYAFSIWE 768
                           *******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.79371749IPR005202Transcription factor GRAS
PfamPF035141.8E-98398768IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MQHSTIGGGG TGTTAKEKLH NDSQLQMAFK NKQSNFVATG GGGESSTLAA KLQQAWLQSR  60
LPKVQDSTPY PSSFDAETRA FDAQAQAFNQ TSREPLTTMT PTATSSSSSS SKASSKTMTT  120
TFTKPRPPTI TSMQTSLFSH LHKSSCGAPP PILHSFSTHD ANLNNHMSFF CDDTNSVGDS  180
NSPSGGLESL AFLDEMLMQD EDIGMDYNEM QVAFLDEMLM EGDDMNVCNP SMYQESTAYQ  240
AVEKGFADLI NEGSRSTSTT GSSYYSSVNS REEGAAAWSA QTECNNVGWN QSLDFNQLSE  300
KIYEDDVLND YTHILCQLVG ELGLESSTNS CSNTSNSHAN HTDVLVREAH NPRTNYKNLS  360
QESTSTGVSM DLPQGSNIGV LQHDVKFAFD SGDEHDLTNL LIICAEAVKQ NDVRNASRII  420
AELRALTSPS GNGAQRMAHY FTDALVAKMS GTGAQLSAAL RSNAPSPATM LRAYKSFVLH  480
APYFTLTHFN INVAILNAFK GATRVHLVAY GLTYGGLFLT LIQQLASRPG GAPNLRITGI  540
EHARDITCKP SELLIRCGQR LSEVAKTYEV PFQYTAIANK WENITATQLA LRPDEVLAVN  600
ASFKLSNFLD ESVMVTNPRQ MFLNKIRSMN PKVFLTSLGS ASLNEPFFMS RVREAIKYYS  660
IQFDTLDVVM PPNLKGRLLI EKEVFFQEIL NIIACEGLER VDRPESYKQW HSRIQRAGFV  720
QKPLQLSETN TIKSILRSYD KRFGIGRDGD WFLSGWRNQA MYAFSIWEPI S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-3640477125381Protein SCARECROW
5b3h_D2e-3640477125381Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.18e-97SCARECROW-like 14