PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0066s0066.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 251aa    MW: 27627.7 Da    PI: 8.6196
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0066s0066.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY42.79.8e-1416322450114
               FLO_LFY  50 eleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavr 114
                           +le++f+++Gvr  tvaki+e+Gft +t++ ++ +el  l++s+ +  ++dl +Ge +Gik a +
  Sphfalx0066s0066.2.p 163 NLENFFEGFGVRPETVAKIKEMGFTGQTFM-LNLDELPSLLESIKQ--QCDLTLGEEWGIKGAAK 224
                           8***************************87.56679*******998..69***********9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.4E-9163224IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MVKVKGVEWN HVVVVKEPEK HGMATLVRCA HCEKEFQGNA MRIRAHLVGN KRAAGVSGCP  60
SCPDKARQEL RLVDEAKSLT QRKREARSRR SSTRTTMSSS APSDHSPDNS GQPVDLMPSL  120
QKGEKMAVEH AFKSMVFQAG GLPLNFVNLS PCKAGPVMSP PINLENFFEG FGVRPETVAK  180
IKEMGFTGQT FMLNLDELPS LLESIKQQCD LTLGEEWGIK GAAKKLHKDH LPVFTQPDVE  240
KWPEPENAQS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369664.11e-121uncharacterized protein LOC112279448
TrEMBLA0A2K1KTT21e-120A0A2K1KTT2_PHYPA; Uncharacterized protein
STRINGPP1S140_156V6.15e-90(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.15e-06floral meristem identity control protein LEAFY (LFY)