PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0059s0101.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 769aa    MW: 84034.5 Da    PI: 5.4737
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0059s0101.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3733.9e-1143947623374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                            lLl+cA+av+++d++ a++ +a+l++++s +g+  qR+a+yf+eAL ar+++++ +ly al+ ++ s     e l+a++lf e++P++
  Sphfalx0059s0101.1.p 394 YLLLRCAQAVEQNDFSHASEQIAELRQHSSAYGNGPQRMAHYFMEALVARMSGTGGQLYTALNNNRPS---ALEMLKAFRLFAETCPFV 479
                           58************************************************************999998...8***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           ++sh   N aI++++  ++rvHi+D++i +G+QWp+L++ L++ p+gpp+lRiTg+++p++g    ++++etg+rLa++Ae  gvpfef
  Sphfalx0059s0101.1.p 480 RMSHYFSNMAIVNEIGDAKRVHIVDYGILYGVQWPCLMNYLSKLPGGPPHLRITGIDRPQAGfrPLDRIKETGRRLAQVAEDHGVPFEF 568
                           *************************************************************9999************************ PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           ++ +a+++e++++ +L ++++E+laVn++++l +l+des   +s+r+ vLk ++s++Pk++v    +a +n++ F  rf ea++++sal
  Sphfalx0059s0101.1.p 569 HA-IAEKWEAITPAHLFLRNDEVLAVNCIFRLRHLMDESIMAASPRNLVLKRIQSMNPKIFVQGVVNAGYNAPFFTSRFREAVSHFSAL 656
                           **.7************************************************************************************* PP

                  GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                           fd+lea++p+e+ +r+ vE+e+lgrei n+vaceg er+er e +++W++r  +aGF+++p+ +++ ++ + l+ +++ d y + e+  
  Sphfalx0059s0101.1.p 657 FDALEASMPAEHPDRVIVEQEILGREILNIVACEGLERVERAEPYKQWQARTLRAGFTQMPILDQTREKCRNLMTTYHRD-YGIGEDGS 744
                           ******************************************************************************66.******** PP

                  GRAS 357 slvlgWkdrpLvsvSaWr 374
                           +l+ gWk+r + ++SaW+
  Sphfalx0059s0101.1.p 745 WLLAGWKERIVHAFSAWQ 762
                           *****************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.111366743IPR005202Transcription factor GRAS
PfamPF035141.3E-111394762IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MAGSKHGRSG GSGGGEVSPL AAQLQQAWLK TQMPKTQKRS LISAPSQGKA GPEVQSPHSP  60
PVPFEEQSAF KSLSSIFPEL AALPQEKKPM IFSVFQEGEG PKSRSLSLLP DDSSNSCPSP  120
FDGMLSGAAK KKTTSSPSLQ HRSLSASPAM LQSSNSFENL AAAAAAPVLS TSRHSSLPSL  180
ADDYSPDYTT GSTPSEGEAG SPIDLQGLDT VDAAVGVEGR NIPFYHYLNS LLDEEPEHNK  240
CMFVECSAYQ AMAKELGDLI GDDSSVQSDT KSSDKEDLDR WLDEITGGPL PDEVPPDGLE  300
HSYESFTGDK GCDLFQNLTV GNGGSWANEV EMLPEAAGVQ SIGPNLDSVC PSSLDDDALH  360
HSNMANGGNG YVSKPTVSQQ ISNGHHIPPV DLNYLLLRCA QAVEQNDFSH ASEQIAELRQ  420
HSSAYGNGPQ RMAHYFMEAL VARMSGTGGQ LYTALNNNRP SALEMLKAFR LFAETCPFVR  480
MSHYFSNMAI VNEIGDAKRV HIVDYGILYG VQWPCLMNYL SKLPGGPPHL RITGIDRPQA  540
GFRPLDRIKE TGRRLAQVAE DHGVPFEFHA IAEKWEAITP AHLFLRNDEV LAVNCIFRLR  600
HLMDESIMAA SPRNLVLKRI QSMNPKIFVQ GVVNAGYNAP FFTSRFREAV SHFSALFDAL  660
EASMPAEHPD RVIVEQEILG REILNIVACE GLERVERAEP YKQWQARTLR AGFTQMPILD  720
QTREKCRNLM TTYHRDYGIG EDGSWLLAGW KERIVHAFSA WQPTPVSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-5539876325380Protein SCARECROW
5b3h_A4e-5539876324379Protein SCARECROW
5b3h_D4e-5539876324379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401598.10.0scarecrow-like protein 30
RefseqXP_024401607.10.0scarecrow-like protein 30
RefseqXP_024401617.10.0scarecrow-like protein 30
TrEMBLA0A2K1L1440.0A0A2K1L144_PHYPA; Uncharacterized protein
STRINGPP1S84_299V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-130SCARECROW-like 14