PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0058s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 319aa    MW: 36518.9 Da    PI: 8.0495
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0058s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY465.83e-142431646385
               FLO_LFY  46 rklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrklls 134
                           ++ r+l+elfk++Gv+ +t+a ++++GftvstL++mkd+e+d ++ks++e ++l+llvGe++Gikaavra+rr l+ee  e++r  +++
  Sphfalx0058s0021.1.p   4 KENRRLKELFKEFGVQPATLALMGQMGFTVSTLMNMKDDEVDFIIKSMIEEYHLELLVGEQFGIKAAVRAKRRALDEEV-EQQRLDIVA 91 
                           56899**********************************************************************9955.667766554 PP

               FLO_LFY 135 edeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsged 223
                           +        +s +  + e+      + g  g+   + +l++ +++ s++e+ k +kkkqk++++ke                    ged
  Sphfalx0058s0021.1.p  92 RTGD---RKISPDDPTSETLL-L--KDGL-GTPRDALGLLGLTDQGSDSENIKVAKKKQKKRRSKE-------------------VGED 154
                           3332...34444443333221.2..2233.333466888888888888888888777777777766...................8999 PP

               FLO_LFY 224 geerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalh 312
                           g+er+rehPfivtepge a+gkknGLDYLfdLyeqC++fL +vq+iake+GekcPtkvtn+vfr+ak +ga yinkPkmr+YvhCYalh
  Sphfalx0058s0021.1.p 155 GQERPREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQQIAKEKGEKCPTKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALH 243
                           ***************************************************************************************** PP

               FLO_LFY 313 cLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                           cLd e+snalr+ +kergenvG w+qacy+plv++a+ ++wdid +fn++++L+iWYvPtkLrqLCh+er k+
  Sphfalx0058s0021.1.p 244 CLDMEQSNALRKVYKERGENVGQWCQACYYPLVSLARGNEWDIDDLFNRNEKLRIWYVPTKLRQLCHIERIKH 316
                           **********************************************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.5E-1143316IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAGKENRRLK ELFKEFGVQP ATLALMGQMG FTVSTLMNMK DDEVDFIIKS MIEEYHLELL  60
VGEQFGIKAA VRAKRRALDE EVEQQRLDIV ARTGDRKISP DDPTSETLLL KDGLGTPRDA  120
LGLLGLTDQG SDSENIKVAK KKQKKRRSKE VGEDGQERPR EHPFIVTEPG EPAKGKKNGL  180
DYLFDLYEQC GKFLEEVQQI AKEKGEKCPT KVTNEVFRHA KLTGAGYINK PKMRDYVHCY  240
ALHCLDMEQS NALRKVYKER GENVGQWCQA CYYPLVSLAR GNEWDIDDLF NRNEKLRIWY  300
VPTKLRQLCH IERIKHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-1171483172171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-1171483172171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143148KKRRSK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024391907.10.0floricaula/leafy-like protein FL1 isoform X1
SwissprotO044071e-141NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLQ9FQ060.0Q9FQ06_9BRYO; AtranFlo1 protein (Fragment)
STRINGPP1S52_67V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.18e-86floral meristem identity control protein LEAFY (LFY)