PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0057s0048.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family VOZ
Protein Properties Length: 244aa    MW: 27301.1 Da    PI: 4.5248
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0057s0048.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ117.41.5e-3612922993202
                   VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldala 181
                           a+lfd+++l+ge ++e lffdkp  afesg  kq         gwh srkqvmkefggl  syymdpqp++ fe hl+eye+++  ++a
  Sphfalx0057s0048.1.p 129 ADLFDVAILHGEVLQERLFFDKPCCAFESGPWKQ---------GWHGSRKQVMKEFGGLNCSYYMDPQPMGLFERHLFEYELSSWTDCA 208
                           68*****************************998.........9********************************************* PP

                   VOZ 182 lyrlelklvdekksakgkvsk 202
                           ly+lelk+vd+ k + ++v  
  Sphfalx0057s0048.1.p 209 LYKLELKQVDASKKNLSQVEG 229
                           ***********9999888865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MHQMLQEWKV ELHETSLASS LLAKPNSSEL SSNMEWLLQL NNEKDDSSSI TLTPPMTNLP  60
LEVANIFPPS IAFLNPKCAL WDCPRPAQGG DEGLVYCSSF HEELALSEGA PGMCLVLRPG  120
GIDLKDTFAD LFDVAILHGE VLQERLFFDK PCCAFESGPW KQGWHGSRKQ VMKEFGGLNC  180
SYYMDPQPMG LFERHLFEYE LSSWTDCALY KLELKQVDAS KKNLSQVEGQ NMFPSLVDSR  240
NSS*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024378749.14e-66transcription factor VOZ1-like isoform X1
RefseqXP_024378752.11e-66transcription factor VOZ1-like isoform X3
SwissprotQ9SGQ05e-55VOZ1_ARATH; Transcription factor VOZ1
TrEMBLV6BQR51e-66V6BQR5_9BRYO; Vascular plant one zinc finger transcription factor protein (Fragment)
STRINGPP1S113_68V6.11e-65(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.22e-57vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]