PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0055s0043.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 696aa    MW: 77999.1 Da    PI: 6.3213
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0055s0043.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.81.3e-1013176853374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                            +Ll+cA+av+++d++l  +l+ +l+++ +p+g+  qR+a yf+e L a++++++ ely a++ ++ s    +e l+a++ + +  P++
  Sphfalx0055s0043.1.p 317 ATLLRCAKAVEQKDFKLGAELIGELRKHTTPYGNGPQRVAYYFMESLVAKMSSTGRELYMAITNNRPS---AAEMLNAMRSYIDNAPFM 402
                           68*********************************************************999888887...89**************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           ++ h  aN+++lea++g++rvH++D++i++G+QWp++++ La+Rp+gpp+lRiTg+++p++g    e+++etg+rLa++A+e+gvpfef
  Sphfalx0055s0043.1.p 403 QVVHCFANNTLLEAFKGASRVHVVDYGIMYGIQWPSFMHMLAQRPGGPPQLRITGIDRPQPGfkPLERIQETGHRLARLAKEVGVPFEF 491
                           *************************************************************99999*********************** PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           ++ +a+++e++++ +L ++++E l Vn++l+  +++des   +s+r+ +L+ ++s++Pkv+v v   a +n + F  rf eal++ s+ 
  Sphfalx0055s0043.1.p 492 HA-IADKWETITPAHLFLRKDEILGVNCALRFRHMMDESIIATSPRTMLLNKIRSMNPKVFVQVVISAGYNLPLFIPRFQEALHHNSVS 579
                           **.7************************************************************************************* PP

                  GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                           fd le+ + +e  eri  E+e+lgr i nvvac g er+er  t+++W  r ++aGF+ +p + ++ ++ +++ +++++d + + e++g
  Sphfalx0055s0043.1.p 580 FDVLEKAMYAEPTERIIFEKEILGRIIFNVVACDGLERVERPGTYREWDTRARQAGFTHLPRNPTIIAKLRAIFNTFQED-FGIGEDDG 667
                           ******************************************************************************66.******** PP

                  GRAS 357 slvlgWkdrpLvsvSaWr 374
                           + + gWk++ L+ ++aW+
  Sphfalx0055s0043.1.p 668 WCLAGWKGHILYGFTAWE 685
                           *****************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.362289666IPR005202Transcription factor GRAS
PfamPF035144.5E-99317685IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MEKTNEKSLV EVSGVVSPLA LQLQEAWLQT QMPKAQKQSL IPLTTTITNT PEEISVRDSI  60
SPLPKDSMLK SLATIFPEVD ATTKQDQPTT PFTQKDGDVS TQPKAIANRN RVHPMNSLIN  120
GVNHVQSIKP SSIMQGSKLP LVKVPPSLTS QPPPHVQSSN VSTLPTSLQK LEPIGVSNVD  180
SFNVVEIVEE NQPLFSYLNG LMDENLEEVI DNDPQMMARE LGVLTDVTTV THEEIGSFPK  240
WTNAWANDRQ NPLQEDDIST SNHFIHGDDP EVGGIMTTND NIEFHDMPKL KYANIPNSHR  300
IEQISNEAHM SANELNATLL RCAKAVEQKD FKLGAELIGE LRKHTTPYGN GPQRVAYYFM  360
ESLVAKMSST GRELYMAITN NRPSAAEMLN AMRSYIDNAP FMQVVHCFAN NTLLEAFKGA  420
SRVHVVDYGI MYGIQWPSFM HMLAQRPGGP PQLRITGIDR PQPGFKPLER IQETGHRLAR  480
LAKEVGVPFE FHAIADKWET ITPAHLFLRK DEILGVNCAL RFRHMMDESI IATSPRTMLL  540
NKIRSMNPKV FVQVVISAGY NLPLFIPRFQ EALHHNSVSF DVLEKAMYAE PTERIIFEKE  600
ILGRIIFNVV ACDGLERVER PGTYREWDTR ARQAGFTHLP RNPTIIAKLR AIFNTFQEDF  660
GIGEDDGWCL AGWKGHILYG FTAWEPAIVN PPSLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-5132168624379Protein SCARECROW
5b3h_D7e-5132168624379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-119SCARECROW-like 14