PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0051s0117.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 1025aa    MW: 110006 Da    PI: 6.6868
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0051s0117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS379.83.4e-11664810232374
                  GRAS    2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87  
                            v+ Ll++Aea + g++e a+a+Larl+++ sp++ +p++R+a yf +AL +++++  +   k lp ++ ++ ++ ++++a+  f ev
  Sphfalx0051s0117.1.p  648 VTYLLKAAEAAEVGNTEVAKAILARLNQHISPARgKPFHRVAYYFQQALLTHMMGAENFSEKLLPDRNLPPLEEYHKINAYVHFCEV 734 
                            678**************************887766********************666666666999999999************** PP

                  GRAS   88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAee 171 
                            sP++kf+h+taNqaI+ea+ege+ vH+iDf ++ G+QW+++lq +as +   + +p++R+T+vg+    +++e+++tg +L+ fA++
  Sphfalx0051s0117.1.p  735 SPVPKFAHFTANQAIMEAMEGENSVHVIDFRLGAGAQWASFLQDIASMQaagKLTPRVRLTAVGP----NSDEMNATGANLSAFAQS 817 
                            **********************************************888655559**********....99**************** PP

                  GRAS  172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258 
                            l++++ef+++v++r + lel++L+++ +Ea+aVn+v++lhrlld++ s     ++vLk+v++ +Pkv++vveqea+hn+++F erf 
  Sphfalx0051s0117.1.p  818 LNISLEFQAVVTSRQQLLELSMLNLRDQEAIAVNFVFSLHRLLDDTFSNGL--SAVLKTVRDAKPKVITVVEQEANHNGSNFQERFY 902 
                            *******************************************88887776..9********************************* PP

                  GRAS  259 ealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342 
                            ea++yy  lfdsl ++l + s     ++++E  ll++ei n+va+ega+r+erhe+le+Wr r+ +aGF++ pls+    qa+ ll+
  Sphfalx0051s0117.1.p  903 EAFQYYLFLFDSLTSSLEPGSdssLVNASIESYLLAPEILNIVAAEGASRVERHERLEQWRIRMCTAGFQSRPLSDASHFQADKLLS 989 
                            *************9999888855567899*********************************************************9 PP

                  GRAS  343 kvk.sdg.yrveeesgslvlgWkdrpLvsvSaWr 374 
                            + +  +g ++v  ++g+l+lgW++rpL+++S+W+
  Sphfalx0051s0117.1.p  990 ERSpRRGgFQVARDNGCLLLGWQGRPLLAASSWT 1023
                            99986655*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512577123No hitNo description
PROSITE profilePS5098553.7786211001IPR005202Transcription factor GRAS
PfamPF035141.2E-1136481023IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MARDLKRTYG GVSGSGNNMG GSCAAASVLP SMHYLARNGE MGGLAAKGSP SDHDITAATH  60
GLLQQLPFPS SSNNVKVERS SSPAAAVYES TGLYHPSFHT GRAGAQAQQA ATEAAAHEAQ  120
SGCGLTENSA LINNGSNSSQ NGGSGSETVD KGGGGGVNPQ RSAEDWWDSW AAPPAPTSAA  180
AAAAAVAEFG TFKAAGGGGY GNFDELDSIM LMLPAPAPDQ TLMRYLMGES QQSHQQGLQA  240
ALQQGGGGVL RMKDMDAVMI EQDSWSSNHE QQQQQSAQSE ISHPHGSGGG DASFSGISPS  300
SAPSCVVGVI PTSAEPTSAF LTPSFPPSLP RALSLPSHMR NITLNSGGEQ HHHHHRPNSE  360
VSVAGVSINM RSMNGPSGGY PFPAAPTSSS SMAAAASYSD SPDSSSSVPG DFFRQTLFSN  420
SSGFQALQTP QENNSFVALQ ASMGMKEVPP PPHPIRGGQT SPSSNQAFRL NHHHHHPPPS  480
LGQGSSCFYQ DSRDIATTTT PPHRNLQRSF TSLPSLSSMD QQMKQLQGMG VNRDYLLQRQ  540
KSWQPGRRSP SRHFISDHQH HHHHHQPHAP NQNTPGDWKL DMSRMQTVRT TSLSPAPPVQ  600
GGFTFSSPKL ESSFKGEEKK EGLVNPPDTG QQQQQEGGVI PEGGLDMVTY LLKAAEAAEV  660
GNTEVAKAIL ARLNQHISPA RGKPFHRVAY YFQQALLTHM MGAENFSEKL LPDRNLPPLE  720
EYHKINAYVH FCEVSPVPKF AHFTANQAIM EAMEGENSVH VIDFRLGAGA QWASFLQDIA  780
SMQAAGKLTP RVRLTAVGPN SDEMNATGAN LSAFAQSLNI SLEFQAVVTS RQQLLELSML  840
NLRDQEAIAV NFVFSLHRLL DDTFSNGLSA VLKTVRDAKP KVITVVEQEA NHNGSNFQER  900
FYEAFQYYLF LFDSLTSSLE PGSDSSLVNA SIESYLLAPE ILNIVAAEGA SRVERHERLE  960
QWRIRMCTAG FQSRPLSDAS HFQADKLLSE RSPRRGGFQV ARDNGCLLLG WQGRPLLAAS  1020
SWTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-5562610232378Protein SCARECROW
5b3h_D2e-5562610232378Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-73RGA-like 2