PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0051s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 667aa    MW: 73485.5 Da    PI: 7.9358
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0051s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.31.7e-1112886562374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lLl+cA++v+++d ++a+ l+ +l++++s +g+ +qR+a yf+eALaarl++++ +ly+a+ ++  +    +  l+a++l+++  P+
  Sphfalx0051s0071.1.p 288 ADLLLRCAKVVEQKDVRKANDLIGELRQHSSAYGNGVQRMAYYFVEALAARLSGTGGRLYAAICSNCPP---PAVLLKAYCLYVDNVPY 373
                           689*********************************************************999777776...6899************* PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                            k+  l  N +Il+a++g++ vH+iD++is+G+QW +L+q La+Rpeg+p+lRiTg+++p++g  s+ ++ etg+rL++fA+  +vpfe
  Sphfalx0051s0071.1.p 374 TKMNRLFSNMTILDAFKGASNVHVIDYGISHGIQWQCLIQHLATRPEGSPHLRITGIDRPQPGfnSSARVLETGHRLTEFAKMWRVPFE 462
                           **************************************************************9*999********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           +++  ++++e++++ +L+++++E+laV++  +lh+lldesv  es+r+ vL+ ++sl+Pkv+v     a +n++ F+ rf e+++++s+
  Sphfalx0051s0071.1.p 463 YHA-FCEKWENISTAQLALRHDEVLAVKCF-KLHYLLDESVMAESPRKIVLNRIRSLKPKVFVEGVVSAGYNAPFFMSRFRECVKHFST 549
                           ***.6***********************95.6********************************************************* PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           +fds+e +lp+++ +r+ +E+e++g+ei n+vaceg er+er e +++W++r ++aGF++ pl+ ++++++k+++  ++++ + + e+ 
  Sphfalx0051s0071.1.p 550 MFDSVEGSLPPDDPDRVLLEQECFGKEILNIVACEGLERVERAEPYRQWQSRTQRAGFTQRPLNPTIMSKMKAMMGSYPKE-FGIGEDG 637
                           *******************************************************************************55.******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                           g+++ gWk++ ++ +S+W+
  Sphfalx0051s0071.1.p 638 GWILTGWKNHIIYGLSSWE 656
                           ******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.426261637IPR005202Transcription factor GRAS
PfamPF035145.8E-109288656IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MQGSNNKSRG EFSSLATQLQ QAWLQSQIPK AAVQKHGGRL SSMIIPATAP QRRLGGSSPS  60
SSFLCPAQPV VDQGCLSSIV PGFATSHRHQ QKTTTVVVAE GVQKSPSSSS AAAFLERCDS  120
SSGFPERPLL PMLSSYSTKT SNFPARRAAV NNNSLEICDY DNSWIDEILG VPEKAQDRTF  180
ADDNGLLLMR DYTHGLGTAA SRGGGFTSVN THLSGNEMDS DSSEYMYEVL NATQYLEREA  240
QAPARIGGYG QSLPQLEQGG GMIPSGAKRW FQAVDGGGCG DLPRVDLADL LLRCAKVVEQ  300
KDVRKANDLI GELRQHSSAY GNGVQRMAYY FVEALAARLS GTGGRLYAAI CSNCPPPAVL  360
LKAYCLYVDN VPYTKMNRLF SNMTILDAFK GASNVHVIDY GISHGIQWQC LIQHLATRPE  420
GSPHLRITGI DRPQPGFNSS ARVLETGHRL TEFAKMWRVP FEYHAFCEKW ENISTAQLAL  480
RHDEVLAVKC FKLHYLLDES VMAESPRKIV LNRIRSLKPK VFVEGVVSAG YNAPFFMSRF  540
RECVKHFSTM FDSVEGSLPP DDPDRVLLEQ ECFGKEILNI VACEGLERVE RAEPYRQWQS  600
RTQRAGFTQR PLNPTIMSKM KAMMGSYPKE FGIGEDGGWI LTGWKNHIIY GLSSWEPNLV  660
ATTAIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A9e-5229365725380Protein SCARECROW
5b3h_A8e-5229365724379Protein SCARECROW
5b3h_D8e-5229365724379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403964.11e-171scarecrow-like protein 33
TrEMBLA0A2K1IYM31e-170A0A2K1IYM3_PHYPA; Uncharacterized protein
TrEMBLA9RPB21e-173A9RPB2_PHYPA; Predicted protein
STRINGPP1S20_86V6.11e-171(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-119GRAS family protein