PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0047s0088.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 654aa    MW: 71642.1 Da    PI: 4.587
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0047s0088.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.12.1e-1392816522373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cAeav s+d  la+ l+a+l++ +s  gdpmqRlaay++e+L ar+ +++++lyk+l+++e++   +++ l+a+++++ev+P+
  Sphfalx0047s0088.1.p 281 EQLLIACAEAVVSKDWPLAKVLVAQLNQAVSIFGDPMQRLAAYMVEGLVARIESTGERLYKTLRCKEAP---TADLLSAMQMLYEVCPY 366
                           689*****************************************************************9...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgv 174
                           +kf++++aN aI ea+++eervHiiDf+i qG+QW++L+qaLa+Rp+gpp+lRiTgv++p +g      +  +e +g rL ++A+++gv
  Sphfalx0047s0088.1.p 367 FKFGYMAANGAIAEAFQNEERVHIIDFEIAQGGQWVTLIQALAARPGGPPHLRITGVDDPGTGfagmsPTGGVELVGVRLGQLAQSVGV 455
                           ***********************************************************999999999999****************** PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           pf f++ vak+ +++e ++L+ +pgEalaVn++lqlh+++desv+++++rd++L++vk+l+Pkv+++ve+ea++n+++F+ rf+eal+y
  Sphfalx0047s0088.1.p 456 PFVFHP-VAKNGTQVEEWMLERQPGEALAVNFALQLHHMPDESVCTTNPRDRILRMVKGLRPKVLTLVEHEANTNTAPFFPRFMEALSY 543
                           ******.7********************************************************************************* PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           +sa+f+sl+ +lpres+er++vE+++l+r+ivn+vace aer+er e l+kWr+r+++aGF+p+pls++++  +k ll+ +++  yr++
  Sphfalx0047s0088.1.p 544 FSAIFESLDITLPRESRERVNVEQQCLARDIVNIVACEDAERVERYELLGKWRARMTMAGFQPYPLSSSVNHAIKILLESYSD-KYRLK 631
                           **********************************************************************************5.5**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaW 373
                           ee g+l+lgW +rpL+++SaW
  Sphfalx0047s0088.1.p 632 EEGGALLLGWVNRPLIVASAW 652
                           ********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.572254634IPR005202Transcription factor GRAS
PfamPF035147.4E-137281652IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MSVQYRPELG TIGLAPQRPG DREKECLLDT ANSQPAPIYY TAKQPYTEKQ RQVQYGVNQI  60
KDQGSPISPL SPPDSSQAAS DVAPSSGRGW SPISFHSETS YRSEGSFEIQ SHHEDVAFYG  120
QPSGASSYSS PSSVPAPTMY QSAATTQSYN TTTYNSGVNH VAEQAQRGYA GSERSSEVEH  180
ALQFFKSALL DDDDDDDEDE TDLAVSLSQG RNTLADGSWA DTLEELLAVE TPPLDLQSQN  240
SATSASGQLA SQQQCQSSSD TYSSAASEEV KTMEETRSLS EQLLIACAEA VVSKDWPLAK  300
VLVAQLNQAV SIFGDPMQRL AAYMVEGLVA RIESTGERLY KTLRCKEAPT ADLLSAMQML  360
YEVCPYFKFG YMAANGAIAE AFQNEERVHI IDFEIAQGGQ WVTLIQALAA RPGGPPHLRI  420
TGVDDPGTGF AGMSPTGGVE LVGVRLGQLA QSVGVPFVFH PVAKNGTQVE EWMLERQPGE  480
ALAVNFALQL HHMPDESVCT TNPRDRILRM VKGLRPKVLT LVEHEANTNT APFFPRFMEA  540
LSYFSAIFES LDITLPRESR ERVNVEQQCL ARDIVNIVAC EDAERVERYE LLGKWRARMT  600
MAGFQPYPLS SSVNHAIKIL LESYSDKYRL KEEGGALLLG WVNRPLIVAS AWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-642826536375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379851.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379861.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379870.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379876.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379885.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379891.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379899.10.0scarecrow-like transcription factor PAT1
SwissprotQ8GVE11e-171CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A2K1L6M10.0A0A2K1L6M1_PHYPA; Uncharacterized protein
STRINGPP1S346_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-164GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]