PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0041s0117.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 581aa    MW: 64908.3 Da    PI: 9.0482
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0041s0117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3435e-1051985666372
                  GRAS   6 lecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                           ++cAe+++++d ++a++l+a+l++++s  g+p qR a+yf+eAL ar+++++ +ly+al+p++ s     e l+a+  +++ +Pi+k+s
  Sphfalx0041s0117.1.p 198 FRCAEVIEENDISQANKLIAELRQHSSAIGNPAQRTAHYFMEALVARMTGTGGQLYRALNPNHPS---APECLKAFLNYFDYCPIPKLS 283
                           68***********************************************************9999...89999***99*********** PP

                  GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.........skeeleetgerLakfAeelgv 174
                           ++ +N aI++a+  ++rvHi+D++i +G+QWp+L+  L++ p+gpp+lRiTg++  ++g         ++e+++etg++La +A++lgv
  Sphfalx0041s0117.1.p 284 YFFCNMAIMQAFGDAKRVHIVDYGILYGMQWPSLIYHLSQLPGGPPHLRITGIDWTKPGfrptetiqeNSERIQETGRNLACVAQQLGV 372
                           ******************************************************99888999999*9999******************* PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           pf+f++ +a+++e++++ +L ++++E+laVn++ +lh+l+de v  +s+r+ +L+ +ks++Pk++v+   + ++n++ F+ rf  a+++
  Sphfalx0041s0117.1.p 373 PFDFHA-IAEKWEAITPAHLFLRSDEVLAVNCINKLHHLFDEYVVAASPRNLFLSRIKSMNPKIFVHGVVNGNYNAPFFMSRFRGAMDH 460
                           ******.7********************************************************************************* PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           ys+lf+ ++a+l   + er+ +E+e+ gr+i n+vaceg er+er e + +W++r  +aGF+++p+ e++ +++++l+ +++ d +++ 
  Sphfalx0041s0117.1.p 461 YSTLFEIYDATL--PHPERVIMEQEVQGRAILNIVACEGLERVERAEPYTSWHARSLRAGFTQIPIPESTKSKIRTLMTHFPRD-FSIG 546
                           ***********9..5789****************************************************************66.**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSa 372
                           e++g+++ gWk++  +++Sa
  Sphfalx0041s0117.1.p 547 EDNGWFLAGWKGKVCYALSA 566
                           *****************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.449167549IPR005202Transcription factor GRAS
PfamPF035141.7E-102198566IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MAGIKNVKSG GSGGEVSPLA AQLQQAWLHT QMPKAKKRSA SSSQLTNSLP VLQQQDQQQS  60
ALESLSSIFP ELASTLPQKK KPRLFSFFQE GEALKPKEKK VCFKDYSLRS SSPSLFPHDT  120
LQSVANRTYS VTPPSPLPHR PTLCASTPVV HNSDSVEHLA AKPVPASQVF SENCPSRSRP  180
SNLVRSFPYL VGLVPFYFRC AEVIEENDIS QANKLIAELR QHSSAIGNPA QRTAHYFMEA  240
LVARMTGTGG QLYRALNPNH PSAPECLKAF LNYFDYCPIP KLSYFFCNMA IMQAFGDAKR  300
VHIVDYGILY GMQWPSLIYH LSQLPGGPPH LRITGIDWTK PGFRPTETIQ ENSERIQETG  360
RNLACVAQQL GVPFDFHAIA EKWEAITPAH LFLRSDEVLA VNCINKLHHL FDEYVVAASP  420
RNLFLSRIKS MNPKIFVHGV VNGNYNAPFF MSRFRGAMDH YSTLFEIYDA TLPHPERVIM  480
EQEVQGRAIL NIVACEGLER VERAEPYTSW HARSLRAGFT QIPIPESTKS KIRTLMTHFP  540
RDFSIGEDNG WFLAGWKGKV CYALSACQPT SRMTSSKQPP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5319957125382Protein SCARECROW
5b3h_A2e-5319957124381Protein SCARECROW
5b3h_D2e-5319957124381Protein SCARECROW
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400152.11e-155scarecrow-like protein 11
RefseqXP_024400154.11e-155scarecrow-like protein 11
TrEMBLA0A2K1J3R71e-154A0A2K1J3R7_PHYPA; Uncharacterized protein
STRINGPP1S98_14V6.11e-155(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-111GRAS family protein