PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0039s0045.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 610aa    MW: 66686.7 Da    PI: 4.6871
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0039s0045.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS324.42.3e-992106013374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPi 90 
                           +lLlecA+av+ +d+ +aq+l++ l+elasp+gd  qRla+yf++AL  ++++++ ++ ++l++ ++++++ ++  ++  l f+e+sP+
  Sphfalx0039s0045.1.p 210 NLLLECARAVAVNDTLRAQNLMSGLNELASPYGDCDQRLASYFLQALFCKITGTGLSCHRILRAAAEKSYSFESLRKMI-LdFQEASPW 297
                           69***************************************************99999999999888855544444444.46******* PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skeeleetgerLakfAeelgvpfef 178
                            +f+h+++N a+lea+ege+ +Hi+D++ + ++QWp+Ll+aLa+R+eg+p++R+ +++ ++++   + ++++  rL +fA+ +gvpfe+
  Sphfalx0039s0045.1.p 298 TTFGHVACNGALLEAFEGETSIHIVDISSTFCTQWPTLLEALATRAEGAPNVRLSAIVVSKEEsAMQIMHQIMMRLDRFARLMGVPFEY 386
                           ********************************************************9997777789999******************** PP

                  GRAS 179 nvlvakrledlel...eeLrvkpgEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvvveqead 247
                           +v    +le l++   ++L+++++Eala+n+++ lh+++                   + + +s+rd++L ++++ +Pkvv++ve e+d
  Sphfalx0039s0045.1.p 387 SVTQLPQLERLQFapgSALELRQDEALAINCIHTLHQVPveelttitgegaggrnnITDIQYSSPRDQILYTFRDANPKVVTIVEDEVD 475
                           *97555777776533379***********************************9876777778899*********************** PP

                  GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaak 335
                           + s++F+  f+eal++y+ lfdsl++++pr+s+er ++Er+  +r+ vn++ac +a  r +r+++   W +rl++ G++  +++e+++ 
  Sphfalx0039s0045.1.p 476 LVSPDFMSCFCEALRFYWLLFDSLDESFPRASKERLMLERA-HARNMVNLLACDEATeRSQRQQKGVDWARRLSHIGLSHSAFTEDVVG 563
                           *****************************************.99999****9976544******************************* PP

                  GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ++++llr++k +g+    +++ l+l+Wkd+p++ +SaW+
  Sphfalx0039s0045.1.p 564 DVRALLRRYK-EGWGFTTDENGLYLTWKDQPVICASAWK 601
                           **********.7777788999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.819182582IPR005202Transcription factor GRAS
PfamPF035148.0E-97210601IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDRLLSSLGS FSPLDQEGRS ELDTSGGSSP SRSVDTILAV DPAALYPAVS HDQPTAGMQL  60
HQAAGLITRP SSTSITSGTR AYNTSTARAG AEYMAISQPV GTVSAQAGIS LFNLDTPTSF  120
ELQERSQYHS SPRLQDEWSE QLLSPDQRSS GSLTPGIASQ AGEAGNVGLT GMVEEFSNPA  180
FIGPSTTAAS GSRSTDQLEL PSTSGHWAPN LLLECARAVA VNDTLRAQNL MSGLNELASP  240
YGDCDQRLAS YFLQALFCKI TGTGLSCHRI LRAAAEKSYS FESLRKMILD FQEASPWTTF  300
GHVACNGALL EAFEGETSIH IVDISSTFCT QWPTLLEALA TRAEGAPNVR LSAIVVSKEE  360
SAMQIMHQIM MRLDRFARLM GVPFEYSVTQ LPQLERLQFA PGSALELRQD EALAINCIHT  420
LHQVPVEELT TITGEGAGGR NNITDIQYSS PRDQILYTFR DANPKVVTIV EDEVDLVSPD  480
FMSCFCEALR FYWLLFDSLD ESFPRASKER LMLERAHARN MVNLLACDEA TERSQRQQKG  540
VDWARRLSHI GLSHSAFTED VVGDVRALLR RYKEGWGFTT DENGLYLTWK DQPVICASAW  600
KSDSESSFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B1e-12320260127419Protein SHORT-ROOT
5b3h_E1e-12320260127419Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379763.10.0protein SHORT-ROOT-like
TrEMBLA0A2K1KCY70.0A0A2K1KCY7_PHYPA; Uncharacterized protein
STRINGPP1S97_39V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-125GRAS family protein