PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0033s0162.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family VOZ
Protein Properties Length: 462aa    MW: 50760.3 Da    PI: 7.3428
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0033s0162.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ362.31.8e-1111854031217
                   VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataksp 89 
                           pp  afl+pkcalwdc+rpaqg ++   ycssfh++lal eg+pg+ pvlrp+gidlkdg+lfaal+a+v+g+ vgipe +gaat+k+p
  Sphfalx0033s0162.1.p 185 PPSIAFLNPKCALWDCPRPAQGGNEGLVYCSSFHEELALSEGAPGMCPVLRPGGIDLKDGPLFAALTARVNGRAVGIPELHGAATSKTP 273
                           66779************************************************************************************ PP

                   VOZ  90 wnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineld 178
                           wna++lfd+++l+ge +rewlffdkprrafesg rkqrslpdy grgwhesrkqvmkefgglkrsyymdpqp + fewhl+eye+++  
  Sphfalx0033s0162.1.p 274 WNATDLFDMAILHGEVLREWLFFDKPRRAFESGTRKQRSLPDYGGRGWHESRKQVMKEFGGLKRSYYMDPQPEGLFEWHLFEYELSSRT 362
                           ***************************************************************************************** PP

                   VOZ 179 alalyrlelklvde.kksakgkvskd.sladlqkklgrlta 217
                           ++alyrlelk+vd+ kk+ k+k ++d s+a lq+++grl+a
  Sphfalx0033s0162.1.p 363 DCALYRLELKQVDAsKKTGKAKAQTDpSIASLQHQIGRLSA 403
                           ************9538999***9988359**********97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAAKHKASRG SQHFRAKATN RVDDLQGMVS ELQQARRQNR LKDVALLEEQ MHQMLREWKA  60
ELREASPASS LLSLQAEPSS SELSSDMERL LQLNNEDDDA SSIALTPSPT TNLPLEAAGT  120
STSQKDCGVS VPELCEIPIP SEGGIEHQAG PTSRKCDDIS YRPVQHNHQT PIATSDMLFK  180
PGIFPPSIAF LNPKCALWDC PRPAQGGNEG LVYCSSFHEE LALSEGAPGM CPVLRPGGID  240
LKDGPLFAAL TARVNGRAVG IPELHGAATS KTPWNATDLF DMAILHGEVL REWLFFDKPR  300
RAFESGTRKQ RSLPDYGGRG WHESRKQVMK EFGGLKRSYY MDPQPEGLFE WHLFEYELSS  360
RTDCALYRLE LKQVDASKKT GKAKAQTDPS IASLQHQIGR LSADLSQVEG QNMLPSLADS  420
RDSSRGRTKL TQKKTITKSA GSGQLVNTAL KGCWTLESHG R*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024378751.10.0transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ01e-140VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2K1KF990.0A0A2K1KF99_PHYPA; Uncharacterized protein
STRINGPP1S113_68V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-132vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]