PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0019s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 827aa    MW: 90797.5 Da    PI: 6.3344
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0019s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3665.3e-1124528202374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lLl+cA+av+++d + a++l+a+l++++sp+g+  qR a+yfteAL ar++r++ +ly al+ ++ s    se l+a++lf+e+ P+
  Sphfalx0019s0042.1.p 452 SNLLLRCAQAVEQNDISHASELIAELRQHSSPYGSGAQRTAHYFTEALVARMSRTGFKLYTALTNNRPS---ASEMLKAFRLFVECVPL 537
                           689*********************************************************999888887...89*************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                            ++sh+  N aI+ a+  ++rvHi+D++i +G+QWp+++  ++    gpp+lRiTg++ p+sg   +e+++etg+rLa++Ae++gvpfe
  Sphfalx0019s0042.1.p 538 TRLSHVFLNLAIMHAIGDAKRVHIVDYGILYGVQWPCFIYHFSR-LPGPPHLRITGIDLPQSGfrPSERIQETGRRLARVAEHVGVPFE 625
                           ******************************************75.6788*************9************************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f++ +a+++e++++ +L ++++E+laVn++++l +lldesv  +s+rd vL+ ++s++Pk++v +  ++ +n++ F+ rf  al++ s+
  Sphfalx0019s0042.1.p 626 FHA-IAEKWEAITPAHLLLRNDEVLAVNCAFRLRHLLDESVVAASPRDLVLNRIRSMNPKIFVEAVVNSGYNAPFFMSRFRAALSHLST 713
                           ***.7************************************************************************************ PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           lf++++a++p e  eri++E+e++gr+i n+vaceg er+er e +++W++r+++aGF+++p+ ek+  ++++++r+++ d y + e+ 
  Sphfalx0019s0042.1.p 714 LFEAFDASMPYEIPERITIEKEMFGRQILNIVACEGLERVERAEPYKQWHSRITRAGFRQLPIMEKTRVKIRSMMRNFHRD-YGIGEDG 801
                           *******************************************************************************66.******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                           ++++ gWkd+ L ++S+W+
  Sphfalx0019s0042.1.p 802 AWFLSGWKDKILHAMSVWE 820
                           ******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.854425801IPR005202Transcription factor GRAS
PfamPF035141.8E-109452820IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MAGSKHDRSG ASGGEVSPLA AQLQQAWMHT QMPKTAKRSS IAAPSSLQQQ SKSTPDHHHH  60
ESYSPRSSSS SPSVATDQSQ SALKSLSSIF PELAALTQQE KKPMISSVFE DGEYPDPTST  120
GQDVIGACPS TLFLKYEENT TTPVSQPNPR SFSASVPGAL HGSNSLEQYL AAATGSAAFL  180
RTSQSFSAGN NNNRSFYTTP AASSLSDAYS SDQYRASTLS PSEAETSGSS SSSSGISSFA  240
ADVDPADPNT FYSYLNDLMD DEPEENKCMF VQASAFQAMA KELGDLIGDH DSPTTPYSDH  300
SRSSEKDPEL ERWLEGVLSG PLPAEVPEQG LKHETTNTKS FANHESAASH EDLLQIFDSG  360
NNNNGSWTAA AACNNGLTGE VYVPGDHGGG AGASPRLSMI DRYKQLDSVS RSEVSEDVDD  420
VLHMPNMSSH VPKPIMSQQL SNGHHGPPVD LSNLLLRCAQ AVEQNDISHA SELIAELRQH  480
SSPYGSGAQR TAHYFTEALV ARMSRTGFKL YTALTNNRPS ASEMLKAFRL FVECVPLTRL  540
SHVFLNLAIM HAIGDAKRVH IVDYGILYGV QWPCFIYHFS RLPGPPHLRI TGIDLPQSGF  600
RPSERIQETG RRLARVAEHV GVPFEFHAIA EKWEAITPAH LLLRNDEVLA VNCAFRLRHL  660
LDESVVAASP RDLVLNRIRS MNPKIFVEAV VNSGYNAPFF MSRFRAALSH LSTLFEAFDA  720
SMPYEIPERI TIEKEMFGRQ ILNIVACEGL ERVERAEPYK QWHSRITRAG FRQLPIMEKT  780
RVKIRSMMRN FHRDYGIGED GAWFLSGWKD KILHAMSVWE PIPISP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-5145782125380Protein SCARECROW
5b3h_A1e-5145782124379Protein SCARECROW
5b3h_D1e-5145782124379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-126SCARECROW-like 14