PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0012s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 862aa    MW: 95097.5 Da    PI: 4.8516
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0012s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.82.9e-1364968591374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lLl+cAea+s+++l+l+++lL++l elasp+g++mqR+aay+te+La r+ar ++++y+ lp    ++  ++++ +a++l+++vsP
  Sphfalx0012s0027.1.p 496 LITLLLACAEAISTKSLSLVNHLLQKLGELASPEGTSMQRIAAYYTEGLACRVARLWPHIYQPLPFDIHHT--EDKNQTAFHLLNHVSP 582
                           5789************************************************************9999985..666677999******* PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                           + kf+h+t+   Il+aveg++rvH+iDfd++qGlQWpaL+++La Rpegpp ++RiTgvg+     ke le tg+rLa+fAe++++pf 
  Sphfalx0012s0027.1.p 583 YTKFAHFTTIDIILQAVEGADRVHVIDFDVKQGLQWPALFHSLAVRPEGPPaHIRITGVGD----CKEDLEDTGDRLAEFAEAFNIPFT 667
                           ***********************************************88888*********....************************ PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f++ v +rled++l++L+vk++Ea+aVn+++qlhrll +s+++ +   ++L+l+k+++P+vv +veqe +hns++F +rfle+l++y a
  Sphfalx0012s0027.1.p 668 FHA-VIDRLEDVRLWMLHVKENEAVAVNCIMQLHRLLYDSGESIK---DFLSLLKTTRPRVVALVEQEGSHNSPNFEARFLESLQFYCA 752
                           ***.7********************************99999888...9**************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           +fdsl+a+l+r+s+ r  vEr  +++ei+n++aceg+er+erhe +++Wr  + +a F +vp++++a +qa+ llr+++ dgy++ ee+
  Sphfalx0012s0027.1.p 753 VFDSLDASLARDSRSRLQVERL-FSQEICNILACEGSERVERHEPFAHWRVLMAQAKFINVPVKKRAKAQADILLRMFEPDGYTLSEED 840
                           *********************9.****************************************************************** PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                           g+l+lgW+d+pL+++SaW+
  Sphfalx0012s0027.1.p 841 GTLTLGWMDQPLFTASAWK 859
                           ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.843470839IPR005202Transcription factor GRAS
PfamPF035149.9E-134496859IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MLKGQHWLDY SSSIEFLEDE TLPRKLPCKG THATKPNALT IQSLDASGLE ALSNNSVSGQ  60
TAAVQSVQAQ LLFQQLSSLL AEQQTVVTPI PTTPDVDVGD PLASPGRVNY GQAHAESITL  120
VTQEEGRQRP HHFNGTMLRQ GECAEVAAEN SPVYVAASSK SYVDGRLATI ENRLAKISAA  180
LAVHVQAPVA ASCTPTCVIE DLGAVVKVAA KSYTTRDTAR PFGNSIDCKS YATELEGPLN  240
SKVDPLLVPE MLAAPGVSTS ATTAPTNWKH SGGKPVLNLS TLNQWETATV ASMQHKGLGE  300
VFPERPILTQ EDNHVVVPPG WSFDNSETDE ALSIASTHHE RPVKGRLRRT RFSCEDDLVI  360
PPLFQNFNDS ETADTLSAEA LSGLDEWEAA TTASTDHERR AKQWMKSLME DLTGQSRGED  420
SMSPKDTETC TPPFTPGAES SQKHPEQQHE SEQQSGSPSR SDCSREDNQA SEYLQEENPG  480
ETWQGGQQSE EVGQELITLL LACAEAISTK SLSLVNHLLQ KLGELASPEG TSMQRIAAYY  540
TEGLACRVAR LWPHIYQPLP FDIHHTEDKN QTAFHLLNHV SPYTKFAHFT TIDIILQAVE  600
GADRVHVIDF DVKQGLQWPA LFHSLAVRPE GPPAHIRITG VGDCKEDLED TGDRLAEFAE  660
AFNIPFTFHA VIDRLEDVRL WMLHVKENEA VAVNCIMQLH RLLYDSGESI KDFLSLLKTT  720
RPRVVALVEQ EGSHNSPNFE ARFLESLQFY CAVFDSLDAS LARDSRSRLQ VERLFSQEIC  780
NILACEGSER VERHEPFAHW RVLMAQAKFI NVPVKKRAKA QADILLRMFE PDGYTLSEED  840
GTLTLGWMDQ PLFTASAWKP E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-8548786010380Protein SCARECROW
5b3h_A1e-854878609379Protein SCARECROW
5b3h_D1e-854878609379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024368133.10.0protein DWARF AND LOW-TILLERING-like
RefseqXP_024368135.10.0protein DWARF AND LOW-TILLERING-like
TrEMBLA0A2K1L2I10.0A0A2K1L2I1_PHYPA; Uncharacterized protein
STRINGPP1S63_198V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-124GRAS family protein