PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0011s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 307aa    MW: 34173.2 Da    PI: 7.9866
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0011s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY406.8e-1320027338114
               FLO_LFY  38 eaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavr 114
                           +a   a+a+++ +l  +f+++Gvr  tv+ki+e+Gft +t++    +el  l++s+ +  ++ l vGe +Gik a +
  Sphfalx0011s0019.1.p 200 KAGGLATATATTDLGTFFEGFGVREETVTKIKEMGFTGKTFMSNL-DELPSLLESIKQ--HCHLSVGEEWGIKGAAK 273
                           4455566677889****************************9866.58999***9998..67789********9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016988.0E-7210273IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MHHTRNIAVT TKTCHCTQVR VFFLRLSVFL FASYEAEDWC FCRRERTEGT GRVMVKVKGV  60
EWNHVVVVKE PEKHGMATLV RCAHCEKEFQ GNAMRIRAHL LGNKRSAGVS GCPSCPEEAW  120
EELRIIDEAK CLTKRKREAR RGLRATSTAL ENGALDNGLQ MELMTSLQKG EKTAMEQAFR  180
NMVFQAGGLP LNFVSVSPFK AGGLATATAT TDLGTFFEGF GVREETVTKI KEMGFTGKTF  240
MSNLDELPSL LESIKQHCHL SVGEEWGIKG AAKKWQKDCS FIFAQPDGEK WCEPENGAVN  300
DCLPQS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369664.11e-121uncharacterized protein LOC112279448
TrEMBLA0A2K1KTT21e-120A0A2K1KTT2_PHYPA; Uncharacterized protein
STRINGPP1S140_156V6.13e-91(Physcomitrella patens)