PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0008s0232.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 757aa    MW: 81286.3 Da    PI: 6.3588
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0008s0232.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.94.5e-1423837551373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cAeav+++d+++a+ ++a+l++++s +gdpmqRlaay++e+L ar+++s+ +lykal+++ ++     + l+a++++++v+P
  Sphfalx0008s0232.2.p 383 LERLLVTCAEAVAENDFQKANVVIAKLNHMVSIHGDPMQRLAAYMLEGLVARMVSSGGGLYKALKCKVAPAAGGGDLLSAMQVLYDVCP 471
                           5789******************************************************************999**************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++kf++++aN aI ea+++e+rvHiiDf+i+qG+QW +L+qaLa+Rp+gpp+lRiTgv++p+s+      l+ +g+rL+k+A+++gvpf
  Sphfalx0008s0232.2.p 472 YFKFGYMAANGAIAEAFQNEDRVHIIDFEINQGVQWSTLIQALAARPGGPPHLRITGVDDPSSEmtPPGGLKLVGNRLRKLAQSVGVPF 560
                           **************************************************************9999999******************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                            f++ v+k++ +++ ++L+ ++gEalaVn++lqlh+++desv+++++rd++L++vksl Pkvv++veqea++n+++Fl rf+ea++yys
  Sphfalx0008s0232.2.p 561 VFHA-VEKKCPEVQAWMLERQHGEALAVNFALQLHHVPDESVCTTNPRDRMLQMVKSLGPKVVTLVEQEANTNTAPFLPRFIEAMKYYS 648
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           a+f sl+++l+r+s+eri+vE+++l+r++vnv+acegaer+erhe l+kWr+r+++aGF+p +ls ++++++k+ll+ +++  yr++ e
  Sphfalx0008s0232.2.p 649 AVFQSLDVTLGRDSRERINVEQQCLARDLVNVIACEGAERVERHEMLGKWRARMSMAGFRPHSLSASVNNTIKMLLEAYSD-KYRLQVE 736
                           ********************************************************************************5.5****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                            g+l lgW++r+L+++SaW
  Sphfalx0008s0232.2.p 737 GGALSLGWMNRSLIVASAW 755
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.728357737IPR005202Transcription factor GRAS
PfamPF035141.5E-139383755IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MMQYRPELGS IGLTLRYPSA SQSRDHRDYF TDTANSQQTA SYYTSCSSTN TTRQAFEDNN  60
QRTSHFVACN TSYASLKPSR DQSSPVSTLS PPDVSTTATT TTTGAFDQAA AASASFQRGG  120
WSSASYQSEG SSGSEASLAS LESQEADFHG RGAFHRGAGD HQQRPAILRS AAASVCGPVP  180
SYQMQQQATS FHEARNIHMS FAAAKQQLYV QQTAAAMGVG GAGRFAAAGG SAAGAEMSGE  240
VVQMLQVLES ALLDDDEDDD MNGSFHQGAA GSSGGADHHM SVSEAGSSWA DAFVDILGAE  300
SCCTQQPLDQ LKATAMEMQQ PSVMSSSCGT AAGLQQQSAY AKQCQKPTKA VVGYAGDHAS  360
KLTAMTEPAQ QLPVKSLLET SQLERLLVTC AEAVAENDFQ KANVVIAKLN HMVSIHGDPM  420
QRLAAYMLEG LVARMVSSGG GLYKALKCKV APAAGGGDLL SAMQVLYDVC PYFKFGYMAA  480
NGAIAEAFQN EDRVHIIDFE INQGVQWSTL IQALAARPGG PPHLRITGVD DPSSEMTPPG  540
GLKLVGNRLR KLAQSVGVPF VFHAVEKKCP EVQAWMLERQ HGEALAVNFA LQLHHVPDES  600
VCTTNPRDRM LQMVKSLGPK VVTLVEQEAN TNTAPFLPRF IEAMKYYSAV FQSLDVTLGR  660
DSRERINVEQ QCLARDLVNV IACEGAERVE RHEMLGKWRA RMSMAGFRPH SLSASVNNTI  720
KMLLEAYSDK YRLQVEGGAL SLGWMNRSLI VASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-7339075526378Protein SCARECROW
5b3h_A3e-7339075525377Protein SCARECROW
5b3h_D3e-7339075525377Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379851.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379861.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379870.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379876.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379885.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379891.10.0scarecrow-like transcription factor PAT1
RefseqXP_024379899.10.0scarecrow-like transcription factor PAT1
TrEMBLA0A2K1L6M10.0A0A2K1L6M1_PHYPA; Uncharacterized protein
STRINGPP1S346_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-166GRAS family protein