PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0007s0025.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 781aa    MW: 86248.7 Da    PI: 6.0539
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0007s0025.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.78.4e-1034077772374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL+ cAeav+++d ++a++++a+l+ l sp+g+  qR+a+yft AL a++++++ +l++al+ ++ s    ++ l a+k ++   P+
  Sphfalx0007s0025.1.p 407 TNLLIICAEAVKQNDVRKASRIIAELRALTSPSGSGAQRMAHYFTDALVAKMSGTGAQLSAALRNNAPS---PATMLRAYKSLVLHAPY 492
                           689************************************************************999998...799999*********** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                            +++h+ +  aIl+a++g+++vH +D++i++G  W++L+++LasRp+g+p+lRiTg+++++      +e l + g+rL++fA++++vpf
  Sphfalx0007s0025.1.p 493 WTLAHFSTTVAILNAFKGATQVHLVDYGIGYGSAWLSLIRELASRPGGAPNLRITGIEKARGIkskPSELLIRCGQRLSEFAKTCEVPF 581
                           ***********************************************************765587789999****************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +f++ +a+++e+++  +L+++p+E+l+Vn  ++  +lldesv + ++r+ +L+ ++s+sPkv+v v  +a++n++ F+ r+ e+++yys
  Sphfalx0007s0025.1.p 582 QFSA-IADKWENITATQLALRPDEVLVVNATYRFSSLLDESVMVINPRQMLLNKIRSMSPKVFVTVVANASLNEPFFMSRVHETIKYYS 669
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           + fd+l++ +p+  +er   E+e+ grei n++aceg er+er e++++W++r+++aGF + pl+ ++++++k++lr ++++ + +  +
  Sphfalx0007s0025.1.p 670 VQFDTLDVIMPPYLNERLLTEQEVYGREILNIIACEGLERVERPESYKQWHSRIQRAGFVQKPLQLSETNTIKSILRSYDKR-FGIGRD 757
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                            g+++ gW+++ + ++S W+
  Sphfalx0007s0025.1.p 758 GGWFLSGWRNQVMNAFSIWE 777
                           *******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.56380758IPR005202Transcription factor GRAS
PfamPF035142.9E-100407777IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MRSPIGRGGV TETTAKEKLH KDPQLQMALT NKQRSFVATG GGSESSPLAA QLQQAWLQSR  60
LPRVQDSTPY PSSIDAESRD FDAEARAFNQ TSKEPLTTTT TTPTTSSPSS SSSKTSSKTM  120
PTKFTKPTPL TSMQTSLFSH RHKSSCGAPP PTLHSFSTHD ANLNNHMSFF SDPYSVGDSN  180
SPNGGPESLA FLDEMLMEEE DINTEQFYMN KESIGYNEMQ VTFLDQMLME GDDMNGSKPC  240
MYQESNAYQA VEKGFADLIT EGSPSTSTTG SSYYSFVNSR EEGAAAWGAQ TECNNVGCYQ  300
SLDFNQLSEK FNEDEMLNDY TDLLCQHLKQ MGLESSTNSS SNSSNSHASH TDVLVLEAHN  360
PTNIYNNLSQ ESSSTGVGMN LPQGTDIGVT QHNVKFAFDS GDEHDLTNLL IICAEAVKQN  420
DVRKASRIIA ELRALTSPSG SGAQRMAHYF TDALVAKMSG TGAQLSAALR NNAPSPATML  480
RAYKSLVLHA PYWTLAHFST TVAILNAFKG ATQVHLVDYG IGYGSAWLSL IRELASRPGG  540
APNLRITGIE KARGIKSKPS ELLIRCGQRL SEFAKTCEVP FQFSAIADKW ENITATQLAL  600
RPDEVLVVNA TYRFSSLLDE SVMVINPRQM LLNKIRSMSP KVFVTVVANA SLNEPFFMSR  660
VHETIKYYSV QFDTLDVIMP PYLNERLLTE QEVYGREILN IIACEGLERV ERPESYKQWH  720
SRIQRAGFVQ KPLQLSETNT IKSILRSYDK RFGIGRDGGW FLSGWRNQVM NAFSIWEPIS  780
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-4141378026382Protein SCARECROW
5b3h_A3e-4141378025381Protein SCARECROW
5b3h_D3e-4141378025381Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-104SCARECROW-like 14