PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0006s0384.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LFY
Protein Properties Length: 322aa    MW: 36957.4 Da    PI: 8.0682
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0006s0384.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY106.15.5e-3339545138
               FLO_LFY  45 arklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkll 133
                            r+ r+l+elfk++Gv+ +t+a +a++GftvstL++mkd+e+d ++ks++e ++l+llvGe++Gika vra+rr l+ee  e++r  +l
  Sphfalx0006s0384.1.p   3 GRENRRLKELFKEFGVQPATLAVMAQMGFTVSTLMNMKDDEVDFVIKSMIEEYHLELLVGEQFGIKAGVRAKRRALDEEM-EQQRLDML 90 
                           567899**********************************************************************9965.66666666 PP

               FLO_LFY 134 sedee 138
                           +++  
  Sphfalx0006s0384.1.p  91 ARNGD 95 
                           44433 PP

2FLO_LFY361.91.1e-110143319209385
               FLO_LFY 209 eeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyi 297
                           +++++++++++ gedgeer+rehPfivtepge a+gkknGLDYLfdLyeqC++fL +vq+iake+GekcPtkvtn+vfr+ak +ga yi
  Sphfalx0006s0384.1.p 143 RKKQKKRHSKEFGEDGEERPREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQQIAKEKGEKCPTKVTNEVFRHAKLTGAGYI 231
                           455666777889***************************************************************************** PP

               FLO_LFY 298 nkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                           nkPkmr+YvhCYalhcLd e+snalr+ +kergenvG w+qacy+plv +a+ +gwdid +fn++++L+iWYvP+kLr+LCh+er k+
  Sphfalx0006s0384.1.p 232 NKPKMRDYVHCYALHCLDMEQSNALRKVYKERGENVGQWCQACYYPLVLLARGNGWDIDDLFNRNEKLRIWYVPAKLRHLCHMERIKH 319
                           *************************************************************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016988.1E-1132319IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAGRENRRLK ELFKEFGVQP ATLAVMAQMG FTVSTLMNMK DDEVDFVIKS MIEEYHLELL  60
VGEQFGIKAG VRAKRRALDE EMEQQRLDML ARNGDRKMNS ADEPPESLLL KDGLGPPRDS  120
IGLLGFTNHP GGSDSEDKKL VARKKQKKRH SKEFGEDGEE RPREHPFIVT EPGEPAKGKK  180
NGLDYLFDLY EQCGKFLEEV QQIAKEKGEK CPTKVTNEVF RHAKLTGAGY INKPKMRDYV  240
HCYALHCLDM EQSNALRKVY KERGENVGQW CQACYYPLVL LARGNGWDID DLFNRNEKLR  300
IWYVPAKLRH LCHMERIKHG E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-1121533204171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-1121533204171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142148RKKQKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7129943e-46JQ712994.1 Sphagnum cuspidatum isolate EK681 LEAFY-like protein (LFY) gene, LFY-short allele, partial cds.
GenBankJQ7129953e-46JQ712995.1 Sphagnum recurvum isolate EK710 LEAFY-like protein (LFY) gene, LFY-short allele, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024391907.11e-175floricaula/leafy-like protein FL1 isoform X1
RefseqXP_024391909.11e-175floricaula/leafy-like protein FL1 isoform X2
SwissprotO044071e-136NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLQ9FQ060.0Q9FQ06_9BRYO; AtranFlo1 protein (Fragment)
STRINGPP1S52_67V6.11e-174(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-84floral meristem identity control protein LEAFY (LFY)