PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0006s0348.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LBD
Protein Properties Length: 122aa    MW: 13198.5 Da    PI: 9.9416
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0006s0348.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-4481071100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Cak+Cv+apyfp ++p+kfanvhk+FGasnv k+lk+lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+ +
  Sphfalx0006s0348.1.p   8 PCAACKLLRRRCAKGCVFAPYFPPDEPQKFANVHKIFGASNVNKMLKDLPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQVIH 96 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++l +++++
  Sphfalx0006s0348.1.p  97 LQSQLTVANAK 107
                           *****999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.197108IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MPGSGMSPCA ACKLLRRRCA KGCVFAPYFP PDEPQKFANV HKIFGASNVN KMLKDLPVHQ  60
RGDAVSSMVY EANARVRDPV YGCVGAISSL QQQVIHLQSQ LTVANAKILS MQMHQAKVVL  120
T*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001775491.15e-67predicted protein
SwissprotQ8LBW31e-60LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA9TA716e-67A9TA71_PHYPA; Predicted protein
STRINGPP1S192_67V6.16e-69(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-62LBD family protein