PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0006s0122.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 990aa    MW: 107419 Da    PI: 6.6843
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0006s0122.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS401.58.2e-1236319862373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             lLl+cAeavs+++  +a+++L +l ela+p+g+++qR++ayfte++a+r++ s+ ++++ lp  +  +   ++ ++a+++f+e++P+
  Sphfalx0006s0122.1.p 631 LALLLQCAEAVSANNVDEANSILPQLTELATPYGSSVQRVVAYFTEGMASRVFTSCLGICSPLPGMQMIS--NQKIVSAVQVFNEICPF 717
                           579************************************************************9999984..6777889********** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                           +kfsh+taNqaI+ea+eg + vHiiD+di++GlQWpaL++ LasRp+gpp++RiTg+g     s e+l++tg+rL++fA++lg+pfe++
  Sphfalx0006s0122.1.p 718 VKFSHFTANQAIVEAFEGMRDVHIIDIDIMHGLQWPALFHILASRPGGPPQVRITGLGT----SMESLQATGKRLSDFAQTLGLPFEYT 802
                           ***********************************************************....************************** PP

                  GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           + va+r+ +++++ L+v+ g+alaV+++   h+l+d +++ ++    +L+l+++lsPkv+++veq++ h ++sF +rf+eal+yysalf
  Sphfalx0006s0122.1.p 803 P-VAERIGNVDPSVLKVRMGDALAVHWMQ--HSLYDVTGDDPQ----TLSLLRRLSPKVITMVEQDLRH-EGSFINRFVEALHYYSALF 883
                           *.7*************************9..999988888888....**********************.899**************** PP

                  GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                           dsl a+++ es er+ vE++ll+ ei+n++a  g +r+  h ++ +W++ l++aGFkpv+ls kaa+qa lll ++  dgy++ e+ g+
  Sphfalx0006s0122.1.p 884 DSLGASYADESPERHIVEQQLLSCEIKNILAVGGPART-GHVKFVQWKDELSQAGFKPVSLSGKAATQATLLLGMFR-DGYTLLEQTGT 970
                           ************************************65.5777**********************************.*********** PP

                  GRAS 358 lvlgWkdrpLvsvSaW 373
                           l lgWk+  L+++SaW
  Sphfalx0006s0122.1.p 971 LKLGWKNLCLLTASAW 986
                           **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.942604968IPR005202Transcription factor GRAS
PfamPF035142.8E-120631986IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 990 aa     Download sequence    Send to blast
MALVCPNRPR ERLGPVLGTG PTSISRLGLC THHVITSGVT QGSAAGESRG INMAENLLSP  60
VSCHNCTSAA SAGALIRQDS AHERSVAGSQ DTGTALKTIG LDHHQPGGPA AAISGLLATV  120
PATWEYNIDA ASNVAPAKLA TQTPAGIWSS SFSFSPGSFT PSSCGDWSIF PQSTVSAPIP  180
PFHAAIGESS SAAMSTSSLS LPGSPLSTVP SHTANCTSST FSNSRGQSAQ NQFYQNSSAQ  240
TVGMLRSASA ASSCNSPWGK LEAGSFDQQR FMLDVTAAPN QQLEVLPRAT RFSAYAAVQG  300
DKDQQPSQSI VNEEHLMHEV DTVSAWVDGT IRELMAAMPG LTLQQLFAKL LEVLEPCNIQ  360
LEKVIEARFH ALFGADQGRR LHKFSAPAAA GSKRMRENTN DQDFNARKEQ EDQYKLEVRR  420
DRRHQQVTAP PLSDPSLKTR RDHHLMTPAP PQTEASPLPS PLSSPAMRDT RDHPRKTLEE  480
GTSIASLQLS LDPRNVVRMR ERSTQAQQSN AAVEDQYQHN MRAQLEMNLQ LPVEQQQRYH  540
QQPPQQHHHH QEPRAKTSPR TYSRTLQASA AEPVQQYGNQ ASLAYQDQTQ LQVQYHDQAA  600
AAGPSATAAS SSSMNVQERI NAYDEAGLEL LALLLQCAEA VSANNVDEAN SILPQLTELA  660
TPYGSSVQRV VAYFTEGMAS RVFTSCLGIC SPLPGMQMIS NQKIVSAVQV FNEICPFVKF  720
SHFTANQAIV EAFEGMRDVH IIDIDIMHGL QWPALFHILA SRPGGPPQVR ITGLGTSMES  780
LQATGKRLSD FAQTLGLPFE YTPVAERIGN VDPSVLKVRM GDALAVHWMQ HSLYDVTGDD  840
PQTLSLLRRL SPKVITMVEQ DLRHEGSFIN RFVEALHYYS ALFDSLGASY ADESPERHIV  900
EQQLLSCEIK NILAVGGPAR TGHVKFVQWK DELSQAGFKP VSLSGKAATQ ATLLLGMFRD  960
GYTLLEQTGT LKLGWKNLCL LTASAWSCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-17862498713379Protein SCARECROW
5b3h_A1e-17862498712378Protein SCARECROW
5b3h_D1e-17862498712378Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024360437.10.0protein SCARECROW 1-like
TrEMBLA0A2K1INB70.0A0A2K1INB7_PHYPA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-170GRAS family protein