PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0004s0331.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LBD
Protein Properties Length: 191aa    MW: 20754.3 Da    PI: 7.8233
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0004s0331.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.5e-42131131101
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da+sslvyeA+ar+rdPvyG++g i++lqqq ++
  Sphfalx0004s0331.1.p  13 PCAACKLLRRRCAQECPFSPYFSPHEPQKFACVHKIFGASNVSKMLMEVPESQRADAASSLVYEANARIRDPVYGCMGAISALQQQAQS 101
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkeel 101
                           l+ael+++++e+
  Sphfalx0004s0331.1.p 102 LQAELNAVRQEI 113
                           ********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.55812113IPR004883Lateral organ boundaries, LOB
PfamPF031957.3E-4213110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MVGNQGQVNS STPCAACKLL RRRCAQECPF SPYFSPHEPQ KFACVHKIFG ASNVSKMLME  60
VPESQRADAA SSLVYEANAR IRDPVYGCMG AISALQQQAQ SLQAELNAVR QEIMRYRRHD  120
NAVADAATAD ATAAMMVQTS GYQGHSLHDR GVTSNPLSTQ TTPSEVYTVP SPNSVTTPDL  180
KERSYWSPLN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279029.14e-71PREDICTED: LOB domain-containing protein 15
RefseqXP_010067593.14e-71PREDICTED: LOB domain-containing protein 15 isoform X3
RefseqXP_010256944.14e-71PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-62LBD13_ARATH; LOB domain-containing protein 13
TrEMBLD7T4G04e-71D7T4G0_VITVI; Putative uncharacterized protein
STRINGPP1S156_26V6.15e-81(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-61LOB domain-containing protein 15