PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0409.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 644aa    MW: 72751 Da    PI: 6.0188
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0409.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS323.83.6e-992636354374
                  GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           lLl+c ea++++dl+ a++++++l+el+sp+g+  qR+a+y+t+AL a++++++ +ly +l+ ++ s   + + l+a++  +   P+ k
  Sphfalx0001s0409.1.p 263 LLLRCGEAIKQNDLKVATQIITKLRELSSPNGNGAQRMAHYVTNALVAKMSGTGAQLYTSLENNNLS---TGTLLQAYRSIVMDVPYTK 348
                           79********************************************************999999888...78999999**999****** PP

                  GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfef 178
                           f+   +   Il+a++g+ +vH+iD++i +G++ p+L+q+L +Rpegpp+l++Tg+++p++    s+e+++etg+rLakfA+ +gvpfe+
  Sphfalx0001s0409.1.p 349 FGIQFCTTQILDAFKGAMHVHVIDYGILYGMHLPCLIQELGKRPEGPPHLQVTGIDHPREPnstSSERVQETGQRLAKFAKLCGVPFEY 437
                           *********************************************************9877788************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            + +ak++e+++l+eL++k++E+laVn+ ++l++lld++v  +++r  +Lk++++++Pkv+v   ++a++n++ F  r+++++++ys  
  Sphfalx0001s0409.1.p 438 IA-IAKEWENITLDELDLKEREVLAVNCFFRLQHLLDNQVVPANPRLFILKMIRTMNPKVFVTGVENASCNEPFFISRLSKTIKHYSIH 525
                           **.7************************************************************************************* PP

                  GRAS 268 fdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq...aklllrkvksdgyrve 352
                           fd+l++  ++ s ++ri+ E+e+lgr+i n++aceg++r+er e++++W++ ++++GF + pl  k+a+q    +++l  ++ + + + 
  Sphfalx0001s0409.1.p 526 FDTLDVVTSSSSeKHRIVFEKEILGRQILNIIACEGTSRVERFESYKQWQRCIQRSGFIQRPLPFKNATQkvnYESILGFYD-KRFGIG 613
                           ****88877777799*******************************************888887766666222466777666.55**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                           +++g+l++gWk++ + ++S W+
  Sphfalx0001s0409.1.p 614 KDDGWLFIGWKNEIMCAFSTWK 635
                           *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.107234613IPR005202Transcription factor GRAS
PfamPF035141.2E-96263635IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MCIYVFQAMA FSNKQSNLVE KGDLSPLTTK LQQAWLQSQL PKVQKNESSP SSFNTSHKVQ  60
YQIDSEPLIH KSLSSHLPEN FFSPLLYSYS TKDSIQYSSF PNHEPLSPKA LTNDGDLKFG  120
EESEPNTITC FDAILMEEDI DKLCMSIECA VSQALQKEFA NLIGENFVPP IDGMVICGNM  180
EVAGEIDSNN ICNNESLDIN QLPQELFEDH LVHEYGNILG ENDSQNEYIN SGVAMCFPHG  240
GEKVQHNVNF AFEFGDDNHL PILLLRCGEA IKQNDLKVAT QIITKLRELS SPNGNGAQRM  300
AHYVTNALVA KMSGTGAQLY TSLENNNLST GTLLQAYRSI VMDVPYTKFG IQFCTTQILD  360
AFKGAMHVHV IDYGILYGMH LPCLIQELGK RPEGPPHLQV TGIDHPREPN STSSERVQET  420
GQRLAKFAKL CGVPFEYIAI AKEWENITLD ELDLKEREVL AVNCFFRLQH LLDNQVVPAN  480
PRLFILKMIR TMNPKVFVTG VENASCNEPF FISRLSKTIK HYSIHFDTLD VVTSSSSEKH  540
RIVFEKEILG RQILNIIACE GTSRVERFES YKQWQRCIQR SGFIQRPLPF KNATQKVNYE  600
SILGFYDKRF GIGKDDGWLF IGWKNEIMCA FSTWKPVPLR MKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-4826663624379Protein SCARECROW
5b3h_D6e-4826663624379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.16e-99SCARECROW-like 14