PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0405.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 641aa    MW: 72773.2 Da    PI: 6.0214
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0405.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.22e-1012606324374
                  GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           lLl+c ea++++dl++a++++ +l+el+sp+g+ +qR+a+y+t+AL a++++ + +ly +l  ++ s   + + l  ++  +   P+++
  Sphfalx0001s0405.1.p 260 LLLKCGEAIEQNDLRMATQIIIKLRELSSPNGNGVQRMAHYVTNALVAKMSGAGAQLYTSLDNNSPS---VGTILRTYRSIVMDVPYVN 345
                           79********************************************************999888888...9999999***9******** PP

                  GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfef 178
                           f+   +   Il+a++g+++vH+iD++i +Gl+Wp+L+q+L +Rpegpp+lRiTg+++ ++    s+e+++etg+rLakfA+ +gvpfe+
  Sphfalx0001s0405.1.p 346 FGIQFCTTQILDAFKGATHVHVIDYGILYGLHWPCLIQELGKRPEGPPHLRITGIDHRREPnstSSERVQETGQRLAKFAKLCGVPFEY 434
                           *******************************************************996655778************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            + +ak++e++++eeL++k++E+la+n+ ++l++lld++v  +++r ++Lk++++++Pkv+v   ++a++n++ F  r+++++++ys  
  Sphfalx0001s0405.1.p 435 IA-IAKEWENITIEELDLKEREVLAINCFFRLQHLLDNQVVPANPRLHILKMIRTMNPKVFVTGVENASCNEPFFISRLSQTIKHYSIH 522
                           **.7************************************************************************************* PP

                  GRAS 268 fdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq...aklllrkvksdgyrve 352
                           fd+l++  ++ s ++ri+ E+e+lgr+i n++aceg++r+er e++++W++ ++++GF + pl  ++a+q    +++l  ++++ + + 
  Sphfalx0001s0405.1.p 523 FDTLDVVTSSISeKHRIVFEKEILGRQILNIIACEGTSRVERFESYKHWQRCIQRSGFIQRPLPFTNADQkvnYESMLGSYDKR-FGIG 610
                           ****88777666699*******************************************99999877777622257889999866.**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                           +++g+l++gWk+  + ++S W+
  Sphfalx0001s0405.1.p 611 KDDGWLFIGWKNAIMCAFSTWK 632
                           *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.231231610IPR005202Transcription factor GRAS
PfamPF035146.8E-99260632IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MCIYVFQAMA FSNKQSNLVE KGDLSPLTTK LQQAWLQSQL PKVQKIESSP FSFNTSHKVR  60
YQTDAEPLIH KSLFSRLPEK FFSPLLYSYS TKDSIQFSSF PNDEPLSSKT LTNVGDLKFD  120
EKSEPNTITY FDAILMEEDI DDKLCMALEC IVCQTLQKEF ANLIGEDFVP PIDGTEICGN  180
MEVGAEIDSN NKSLDINQLP QELFEDHLVH ECGNILGEND SQNEYISAGM TMCLPHGGEK  240
VQHNVDFTFE FGDDNHLPIL LLKCGEAIEQ NDLRMATQII IKLRELSSPN GNGVQRMAHY  300
VTNALVAKMS GAGAQLYTSL DNNSPSVGTI LRTYRSIVMD VPYVNFGIQF CTTQILDAFK  360
GATHVHVIDY GILYGLHWPC LIQELGKRPE GPPHLRITGI DHRREPNSTS SERVQETGQR  420
LAKFAKLCGV PFEYIAIAKE WENITIEELD LKEREVLAIN CFFRLQHLLD NQVVPANPRL  480
HILKMIRTMN PKVFVTGVEN ASCNEPFFIS RLSQTIKHYS IHFDTLDVVT SSISEKHRIV  540
FEKEILGRQI LNIIACEGTS RVERFESYKH WQRCIQRSGF IQRPLPFTNA DQKVNYESML  600
GSYDKRFGIG KDDGWLFIGW KNAIMCAFST WKPIPLRIKV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-5026363324379Protein SCARECROW
5b3h_D2e-5026363324379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.15e-97SCARECROW-like 14