PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0305.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 719aa    MW: 79636.7 Da    PI: 6.15
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0305.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.31.4e-1003467162374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cAeav+++d ++a++++a+l+ l sp+g+  qR+a+yft AL a++++++++l++al+ ++ s    ++ l a+k+++   P+
  Sphfalx0001s0305.1.p 346 TNLLITCAEAVKQNDVRKASRIIAELRALTSPSGSGAQRMAHYFTDALVAKMFGTGPQLSAALRNNAPS---PATMLRAYKALVLHGPY 431
                           789************************************************************999998...799999*********** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                           l+++h+    a l+a++g++rvH +D+++++G+  ++L+q+La+Rp+g+p+lRiTg+++++ +    +e l + g+rL++fA++ +vpf
  Sphfalx0001s0305.1.p 432 LTLAHFSITVANLNAFKGATRVHLVDYGLNYGGPQLSLIQELAKRPGGAPNLRITGIEQAHDTkckPSELLIRCGQRLSEFAKTYEVPF 520
                           ***********************************************************77779999999******************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ++++ +a+++e+++  +L+++p+E+l+Vn++ +  +lldesv + ++r+ +L+ ++s++Pkv+v +  +a++n++ F+ r+ e+++yys
  Sphfalx0001s0305.1.p 521 QYTA-IADKWENITATQLALRPDEVLVVNVASKASNLLDESVMVVNARQMFLSKIRSMNPKVFVAAVANASLNEPFFMSRVRETIKYYS 608
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                             fd+l++ +p+  +er  +E+el grei n++aceg er+er e++++W++r+++aGF + pl+ ++++++k++lr ++++ + +  +
  Sphfalx0001s0305.1.p 609 IQFDMLDVIMPPCLKERFLIEQELYGREILNIIACEGLERTERPESYRQWHSRIQRAGFVQKPLQLSETNTIKSILRSYDKR-FGIGRD 696
                           ********************************************************************************77.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                            g+++ gW+++ + ++S W+
  Sphfalx0001s0305.1.p 697 GGWFLSGWRNQVMNAISIWE 716
                           *******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.024319697IPR005202Transcription factor GRAS
PfamPF035145.0E-98346716IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MQHSAIGRGG GAGTTGKEKL HKDSQLQMAF TNKQSNFVAA AGGGESTPLA AKLQQAWLQS  60
RLPKEQDSTP YSSSSDAETQ AFDSEAQAFN QKSREPLTMT TPTTTTTSSS SSNTMTTTFT  120
KPTPPTITSM QTSLFSHLHK SSYGAPPPIL HSFSTHDANL NNHMSFFSED PYSVGDSDSP  180
TGGPESLAFL DEMLMQEEED IDTEQLYMNE ESMDYNEMQV TFLDQMLMEG DVMSGSKPSL  240
YQESTAYQAM EKGFADLINE DILSRHIGEL SLESSTNICS NSSNNNANHT DVLMRETHNP  300
RTIYKNMSQE STSTRVSMNL PQGSNIGVLQ HNTKFAFDSG DEHDLTNLLI TCAEAVKQND  360
VRKASRIIAE LRALTSPSGS GAQRMAHYFT DALVAKMFGT GPQLSAALRN NAPSPATMLR  420
AYKALVLHGP YLTLAHFSIT VANLNAFKGA TRVHLVDYGL NYGGPQLSLI QELAKRPGGA  480
PNLRITGIEQ AHDTKCKPSE LLIRCGQRLS EFAKTYEVPF QYTAIADKWE NITATQLALR  540
PDEVLVVNVA SKASNLLDES VMVVNARQMF LSKIRSMNPK VFVAAVANAS LNEPFFMSRV  600
RETIKYYSIQ FDMLDVIMPP CLKERFLIEQ ELYGREILNI IACEGLERTE RPESYRQWHS  660
RIQRAGFVQK PLQLSETNTI KSILRSYDKR FGIGRDGGWF LSGWRNQVMN AISIWEPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-3735271725379Protein SCARECROW
5b3h_D3e-3735271725379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9RPB21e-134A9RPB2_PHYPA; Predicted protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.13e-98SCARECROW-like 14