PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0072.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family LBD
Protein Properties Length: 237aa    MW: 24050.1 Da    PI: 7.9055
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0072.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.24.5e-4691081100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasn++kll++lp+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++q
  Sphfalx0001s0072.1.p   9 PCAACKFLRRKCTTECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPPHKREDAVNSLAYEADARVKDPVYGCVGAISLLQRQVAQ 97 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l++ela +++ 
  Sphfalx0001s0072.1.p  98 LQNELAIAHSD 108
                           ******99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3428109IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-459106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MASSSSSSPC AACKFLRRKC TTECVFAPYF PPDQPHKFAN VHKIFGASNI TKLLNELPPH  60
KREDAVNSLA YEADARVKDP VYGCVGAISL LQRQVAQLQN ELAIAHSDLA RYAGAGMVVG  120
PPAGAAQAGA AGPSSASSLG IGMGLSAGGN QSAGREQMLT REQLIDLARE PPQLTREQIM  180
ELARVGGGSY EAGLAALGLT GALGPLGPSY PSSRTGGGDH SGNGSGSAGG HISPAP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FML43e-62LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
STRINGPP1S170_93V6.11e-107(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-59LBD family protein