PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0000s0632.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 655aa    MW: 73970.1 Da    PI: 7.1505
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0000s0632.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.85.2e-1012756462374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            + L++cAea+ ++d ++a+ ++a+l++l+s++g+ +qR+a+y+t AL a+++++ ++ly a   ++ +  +    + a++ + e +P+
  Sphfalx0000s0632.1.p 275 ANKLIKCAEAIGQNDVKNANGIIAELHDLSSSNGNGVQRMAHYVTTALVAKMFGTATQLYTATCNNTPA--TGRIITRAYRSLWEYTPY 361
                           578*********************************************************876444444..47777789********** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqG.lQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                            k+ h+     I++  +++++vH +D++i++G l+Wp+++q+La R++gpp++RiTg+++p +     +++++e+g+ L++fA+  +vp
  Sphfalx0000s0632.1.p 362 CKLHHMFSDANIMDVCKNASQVHLVDYGIMYGsLHWPCFIQQLAMREQGPPHVRITGIDQPYPRtskPSKRVQEIGQMLSEFAKLWKVP 450
                           *******************************967**************************988888899******************** PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           fef++ +a+++e++++ +L+++++E+l+V + ++l +l+d sv+ +++r+ vL+ +++++Pkv+v    +a++n++ F+ r+ e++++y
  Sphfalx0000s0632.1.p 451 FEFTA-IAEKWENITPTKLSLRKNEVLIVTCFFKLRNLMDASVTATNPRTMVLNNIRTMNPKVFVTGVVNANCNEPFFMSRVHETIKHY 538
                           *****.7********************************************************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           s+ fd++++ +p++  +r+ +E+   grei n++ ceg+er+er e++++W++r+++aGF + pl  ++ +++k++l +++++ + + +
  Sphfalx0000s0632.1.p 539 STKFDTMDVVIPSNMIKRRELEEI-YGREILNIIGCEGTERIERPESYKQWHSRIQRAGFVQKPLCPFIDSTIKSILGTCHKH-FGIGQ 625
                           ***********************9.9*******************************************************55.***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                           + g++++gWk++ ++++SaW+
  Sphfalx0000s0632.1.p 626 DGGWFLMGWKNEIVYALSAWK 646
                           ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.576248627IPR005202Transcription factor GRAS
PfamPF035141.8E-98275646IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MTFTDKQNSL ARGDGHLPLA TKLQQVLLQS QLPKPQNSGS SPLSSSNETQ KSSRSYKSLI  60
SNFPIRSSVP MLYSYSTKDS NLGTNESRSM GDFSYGGEPK PLITCLDEML MEDDISDDLN  120
MCLHQEDVAY QTIEKGFADL IDKDSLSQAH GNKTFDFDER KRFEEYNNVW KIESLNFTQL  180
SEKIMEDHLM NELCQHEAQS PCVSVSSQSN SGDVVTNNVH CMDPMHNISN PFSSNELKGH  240
INTTMGIYRP FNVNGGIEDN AIKFVFTNGD ENQLANKLIK CAEAIGQNDV KNANGIIAEL  300
HDLSSSNGNG VQRMAHYVTT ALVAKMFGTA TQLYTATCNN TPATGRIITR AYRSLWEYTP  360
YCKLHHMFSD ANIMDVCKNA SQVHLVDYGI MYGSLHWPCF IQQLAMREQG PPHVRITGID  420
QPYPRTSKPS KRVQEIGQML SEFAKLWKVP FEFTAIAEKW ENITPTKLSL RKNEVLIVTC  480
FFKLRNLMDA SVTATNPRTM VLNNIRTMNP KVFVTGVVNA NCNEPFFMSR VHETIKHYST  540
KFDTMDVVIP SNMIKRRELE EIYGREILNI IGCEGTERIE RPESYKQWHS RIQRAGFVQK  600
PLCPFIDSTI KSILGTCHKH FGIGQDGGWF LMGWKNEIVY ALSAWKPTIS LTKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-4028064725380Protein SCARECROW
5b3h_A7e-4028064724379Protein SCARECROW
5b3h_D7e-4028064724379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-97SCARECROW-like 14