PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G267500.1.p
Common NameSb10g030250, SORBIDRAFT_10g030250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 274aa    MW: 29201.7 Da    PI: 6.4948
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G267500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.66.2e-09101144851
                           HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                           +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++
  Sobic.010G267500.1.p 101 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQS 144
                           56667***********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-794161IPR004827Basic-leucine zipper domain
PfamPF077162.4E-1595151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-1297162No hitNo description
SuperFamilySSF579594.64E-899145No hitNo description
CDDcd146864.62E-12106153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDDGDLDFSN PDTYLCPALG TDPPSSCSMD SYFDEILKDT EHHACTHTHT CNPPVHDLSH  60
THTCVHVHTK IVAASPGDDA AESPSENNTN TTGNSNAASK KRPSGNRAAV RKYREKKKAH  120
TASLEEEVVH LRALNQQLMK KLQSHATLEA EVARLRCLLV DIRGRIEGEI GAFPYQRPPV  180
KNVDLVSSVD QGSFLGGAGT AQVTNACDFR CKDQMYCNPG MQGAISGQVL GQGACDVASI  240
QCIGSNKSGS TKLPVCGGMD TVPAVCLPNV ENK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.150410.0callus| leaf| pollen| root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G267500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0403040.0BT040304.1 Zea mays full-length cDNA clone ZM_BFc0080C17 mRNA, complete cds.
GenBankHQ8586620.0HQ858662.1 Zea mays clone UT601 bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439031.10.0basic leucine zipper 23
RefseqXP_021305063.10.0basic leucine zipper 23
SwissprotQ8VY766e-74BZP19_ARATH; Basic leucine zipper 19
TrEMBLC5Z1W50.0C5Z1W5_SORBI; Uncharacterized protein
STRINGSb10g030250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-64bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]