PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G037701.1.p
Common NameSb10g003350, SORBIDRAFT_10g003350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 147aa    MW: 16220.7 Da    PI: 8.5069
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G037701.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.54.6e-191643699
                DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                          +FG++n++++l+++p+ +r+  ++++vye++ ra dPv+G++gvi++l++ql+ +++el++l++
  Sobic.010G037701.1.p  1 MFGVKNLQRMLQKVPPPRRDVCVQTIVYESNLRAADPVRGCCGVIQDLENQLMDTAVELEVLRR 64
                          7**********************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.253166IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-17163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MFGVKNLQRM LQKVPPPRRD VCVQTIVYES NLRAADPVRG CCGVIQDLEN QLMDTAVELE  60
VLRRRLESYR RMARGSHSQS QPPNPLAIQQ QLMARTSHDT QTQGPSGVGV PPAANELTAT  120
LPQLPAMEME PQLSQVPQPR LSTMPP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G037701.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436474.11e-101LOB domain-containing protein 22
TrEMBLA0A1W0VRC01e-101A0A1W0VRC0_SORBI; Uncharacterized protein
STRINGSb10g003350.11e-101(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1968178
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-17LOB domain-containing protein 22