PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G030100.1.p
Common NameSb10g002740, SORBIDRAFT_10g002740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 286aa    MW: 29326.9 Da    PI: 9.7154
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G030100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1993147256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Sobic.010G030100.1.p  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTK 147
                           788899***********************************************98 PP

2HD-ZIP_I/II126.89.5e-4193181190
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL kev+eLr 
  Sobic.010G030100.1.p  93 RKKLRLSKDQAAVLEECFKTHHTLTPKQKVALASSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCEQLAEENRRLGKEVAELR- 180
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 e 90 
                           +
  Sobic.010G030100.1.p 181 A 181
                           4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-1979143IPR009057Homeodomain-like
PROSITE profilePS5007116.60189149IPR001356Homeobox domain
SMARTSM003893.8E-1791153IPR001356Homeobox domain
SuperFamilySSF466892.87E-1892158IPR009057Homeodomain-like
CDDcd000861.95E-1493150No hitNo description
PfamPF000467.3E-1793147IPR001356Homeobox domain
PRINTSPR000311.7E-5120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000311.7E-5129145IPR000047Helix-turn-helix motif
PfamPF021838.3E-11149182IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.3E-22149192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MAPQSLDLGL SLGLGVAAFQ PSLSFCHPAA GNAAAVAGAA ERDASPATAE ERERRCSPAG  60
SPVSSGSGSG SGKRAAAERS AGSGDEDDDG AARKKLRLSK DQAAVLEECF KTHHTLTPKQ  120
KVALASSLGL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR WCEQLAEENR RLGKEVAELR  180
ALSAAPAPAA PLTTLTMCLS CRRVASSSSP SSANTSSPNN IPAAHPHAHA AAAASNGGSM  240
ASSPAAAATL PAHRQFFCGF RDAGAAAAAV YGVSSGLAKA VRAAR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.11502e-85pollen
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G030100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9681200.0EU968120.1 Zea mays clone 314746 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436445.10.0homeobox-leucine zipper protein HOX28
SwissprotA2Y9311e-65HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE51e-65HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLC5Z3S60.0C5Z3S6_SORBI; Uncharacterized protein
STRINGSb10g002740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-43homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]