PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G017400.1.p
Common NameSb10g001690, SORBIDRAFT_10g001690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 638aa    MW: 67525.7 Da    PI: 6.9358
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G017400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.51.9e-1192406112374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsev 87 
                           v +L++cA+ +++ ++ +a+ +Larl e+asp+g +pm+R+aayf+eALa r++r+++++++  pp+e ++     ++ ++al++++ v
  Sobic.010G017400.1.p 240 VVALTACADSLAACNHDAANYYLARLGEMASPAGpTPMHRVAAYFAEALALRVVRMWPHVFDVAPPRELTDGAvaDDDDATALRVLNAV 328
                           5689*****************************************************************9888666778888999**** PP

                  GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvp 175
                           +Pi++f h+t N+ +l+a++g++rvH+iDfdi+qGlQWp Llq+La+R++gpp ++RiTgvg+    s++el+etg rL ++A++lg+ 
  Sobic.010G017400.1.p 329 TPIPRFLHFTLNERVLRAFDGHDRVHVIDFDIKQGLQWPGLLQSLATRASGPPaHVRITGVGE----SRQELQETGARLGRVAAALGLA 413
                           *************************************************88887*********....9********************* PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           fef++ v++rled++l++L+vk+gE++aVn+vl+ hrll++++  +    ++L l +s+ + ++ + e+e  +ns+++ +rf++al+yy
  Sobic.010G017400.1.p 414 FEFHA-VVDRLEDVRLWMLHVKRGECVAVNCVLAAHRLLRDETGAAI--ADFLGLARSTGAAILLLGEHEDALNSGRWEARFARALRYY 499
                           *****.7********************************88877777..99************************************** PP

                  GRAS 265 salfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           +a fd++ +a+l+ +s +r+k E++ ++rei+n+va e  +r+erhet++ Wr+r++e GF+++ ++e++a+q +++ r+++   y+v+
  Sobic.010G017400.1.p 500 AAAFDAVdAAGLADTSPARAKAEEM-FAREIRNAVAFEAGDRFERHETFAGWRRRMQEGGFQNAGIGEREAMQGRMIARMFAPGNYSVQ 587
                           *******9999**************.********************************************************555*999 PP

                  GRAS 353 ee..sgslvlgWkdrpLvsvSaWr 374
                            +   + l+l W+d+++++vSaW+
  Sobic.010G017400.1.p 588 AQgdGEGLTLRWMDQAMYTVSAWT 611
                           554367788**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.069213589IPR005202Transcription factor GRAS
PfamPF035146.6E-117240611IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MEVLLGFAAR RCLGGRSAAA RALLQRMSTA QRFDILPYGF SKRATNRGDG PGASAAPRVA  60
AADARTGGGG TCSFRAHPAP PVTQAVSWGA KPEPGGNGAG AVWERSRAVK RAHEEDTGEE  120
YSGPVVRAKR TRRGGDGDEV WLHRSIAGTV QAAGSGDGEE AEEEKVFLVP SAAAFPHGMS  180
AAAGPSLAAA KKEEFSKSPS NSPASSGGTD GGSSAAVPRP EQLHAHNGAP AQRVEAMELV  240
VALTACADSL AACNHDAANY YLARLGEMAS PAGPTPMHRV AAYFAEALAL RVVRMWPHVF  300
DVAPPRELTD GAVADDDDAT ALRVLNAVTP IPRFLHFTLN ERVLRAFDGH DRVHVIDFDI  360
KQGLQWPGLL QSLATRASGP PAHVRITGVG ESRQELQETG ARLGRVAAAL GLAFEFHAVV  420
DRLEDVRLWM LHVKRGECVA VNCVLAAHRL LRDETGAAIA DFLGLARSTG AAILLLGEHE  480
DALNSGRWEA RFARALRYYA AAFDAVDAAG LADTSPARAK AEEMFAREIR NAVAFEAGDR  540
FERHETFAGW RRRMQEGGFQ NAGIGEREAM QGRMIARMFA PGNYSVQAQG DGEGLTLRWM  600
DQAMYTVSAW TPISDGGGGG STVSASVSTT ASHSQQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-452396104374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436390.10.0hypothetical protein SORBIDRAFT_10g001690
SwissprotQ9CAN31e-143SCL28_ARATH; Scarecrow-like protein 28
TrEMBLC5Z3740.0C5Z374_SORBI; Putative uncharacterized protein Sb10g001690
STRINGSb10g001690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55071521
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-117GRAS family protein