PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G017400.1.p
Common NameSb10g001690, SORBIDRAFT_10g001690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 638aa    MW: 67525.7 Da    PI: 6.9358
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G017400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.51.9e-1192406112374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsev 87 
                           v +L++cA+ +++ ++ +a+ +Larl e+asp+g +pm+R+aayf+eALa r++r+++++++  pp+e ++     ++ ++al++++ v
  Sobic.010G017400.1.p 240 VVALTACADSLAACNHDAANYYLARLGEMASPAGpTPMHRVAAYFAEALALRVVRMWPHVFDVAPPRELTDGAvaDDDDATALRVLNAV 328
                           5689*****************************************************************9888666778888999**** PP

                  GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvp 175
                           +Pi++f h+t N+ +l+a++g++rvH+iDfdi+qGlQWp Llq+La+R++gpp ++RiTgvg+    s++el+etg rL ++A++lg+ 
  Sobic.010G017400.1.p 329 TPIPRFLHFTLNERVLRAFDGHDRVHVIDFDIKQGLQWPGLLQSLATRASGPPaHVRITGVGE----SRQELQETGARLGRVAAALGLA 413
                           *************************************************88887*********....9********************* PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           fef++ v++rled++l++L+vk+gE++aVn+vl+ hrll++++  +    ++L l +s+ + ++ + e+e  +ns+++ +rf++al+yy
  Sobic.010G017400.1.p 414 FEFHA-VVDRLEDVRLWMLHVKRGECVAVNCVLAAHRLLRDETGAAI--ADFLGLARSTGAAILLLGEHEDALNSGRWEARFARALRYY 499
                           *****.7********************************88877777..99************************************** PP

                  GRAS 265 salfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           +a fd++ +a+l+ +s +r+k E++ ++rei+n+va e  +r+erhet++ Wr+r++e GF+++ ++e++a+q +++ r+++   y+v+
  Sobic.010G017400.1.p 500 AAAFDAVdAAGLADTSPARAKAEEM-FAREIRNAVAFEAGDRFERHETFAGWRRRMQEGGFQNAGIGEREAMQGRMIARMFAPGNYSVQ 587
                           *******9999**************.********************************************************555*999 PP

                  GRAS 353 ee..sgslvlgWkdrpLvsvSaWr 374
                            +   + l+l W+d+++++vSaW+
  Sobic.010G017400.1.p 588 AQgdGEGLTLRWMDQAMYTVSAWT 611
                           554367788**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.069213589IPR005202Transcription factor GRAS
PfamPF035146.6E-117240611IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MEVLLGFAAR RCLGGRSAAA RALLQRMSTA QRFDILPYGF SKRATNRGDG PGASAAPRVA  60
AADARTGGGG TCSFRAHPAP PVTQAVSWGA KPEPGGNGAG AVWERSRAVK RAHEEDTGEE  120
YSGPVVRAKR TRRGGDGDEV WLHRSIAGTV QAAGSGDGEE AEEEKVFLVP SAAAFPHGMS  180
AAAGPSLAAA KKEEFSKSPS NSPASSGGTD GGSSAAVPRP EQLHAHNGAP AQRVEAMELV  240
VALTACADSL AACNHDAANY YLARLGEMAS PAGPTPMHRV AAYFAEALAL RVVRMWPHVF  300
DVAPPRELTD GAVADDDDAT ALRVLNAVTP IPRFLHFTLN ERVLRAFDGH DRVHVIDFDI  360
KQGLQWPGLL QSLATRASGP PAHVRITGVG ESRQELQETG ARLGRVAAAL GLAFEFHAVV  420
DRLEDVRLWM LHVKRGECVA VNCVLAAHRL LRDETGAAIA DFLGLARSTG AAILLLGEHE  480
DALNSGRWEA RFARALRYYA AAFDAVDAAG LADTSPARAK AEEMFAREIR NAVAFEAGDR  540
FERHETFAGW RRRMQEGGFQ NAGIGEREAM QGRMIARMFA PGNYSVQAQG DGEGLTLRWM  600
DQAMYTVSAW TPISDGGGGG STVSASVSTT ASHSQQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-622186142382Protein SCARECROW
5b3h_A3e-6224661225379Protein SCARECROW
5b3h_D3e-6224661225379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the shoot apical meristem (SAM) and elongating cells of young seedlings. Expressed in leaf joints, culms, internodes, stems, young panicles, primary roots and lateral roots. {ECO:0000269|PubMed:19220793}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G017400.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436390.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9LWU90.0DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLC5Z3740.0C5Z374_SORBI; Uncharacterized protein
STRINGSb10g001690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Representative plantOGRP55071521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-117GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]