PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G234100.1.p
Common NameSb09g028660, SORBIDRAFT_09g028660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 425aa    MW: 44449.3 Da    PI: 6.8825
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G234100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.3e-33194251259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s+fprsYYrCt+++Cpvkk+vers +d  vv++tYeg+H+h+
  Sobic.009G234100.1.p 194 EDGYRWRKYGQKAVKNSPFPRSYYRCTTQKCPVKKRVERSYQDAAVVITTYEGKHTHP 251
                           8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-35178253IPR003657WRKY domain
SuperFamilySSF1182903.66E-29185253IPR003657WRKY domain
PROSITE profilePS5081131.95188253IPR003657WRKY domain
SMARTSM007743.2E-39193252IPR003657WRKY domain
PfamPF031063.1E-26194251IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MSGARHEHHL SGDFQFHDEL ASLFAHQRPD AAPMAQPWFM DYLHATAAAA SPLDCDAFVG  60
DFIDVPAVAA DEVVKRELVM VDTAAAGSGG GTPTPTTAPL TPNSMSMSST SSEACGAGAG  120
AGEESAAGKC KKEDGEEEGL ESKDDGSAAG KGDGGEGEEK NKKGAANKGK GKGEKRPRQP  180
RFAFMTKSEV DHLEDGYRWR KYGQKAVKNS PFPRSYYRCT TQKCPVKKRV ERSYQDAAVV  240
ITTYEGKHTH PIPATLRGSS HLLAAAHHHP MGGLHHVHPH FRMAPPPPPA ALGGFRPGGG  300
ANAFDALGLG LLQPPSSSQQ QQQGHHHHHG AAAMQQLAVS GGAAGVQQVN AAAAMASHAA  360
LPDDGDQHGL AAIAGAAGTT TAATTAASAP LRMQHFMAQD YAGLLQDMFP SFVHSDDDGH  420
HHHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26184254878Probable WRKY transcription factor 4
2lex_A2e-26184254878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1016651e-132FP101665.1 Phyllostachys edulis cDNA clone: bphyem202m15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440260.10.0hypothetical protein SORBIDRAFT_09g028660
TrEMBLC5YVV80.0C5YVV8_SORBI; Putative uncharacterized protein Sb09g028660
STRINGSb09g028660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.16e-46WRKY DNA-binding protein 71