PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G212800.1.p
Common NameSb09g026830, SORBIDRAFT_09g026830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 220aa    MW: 22716.9 Da    PI: 6.5159
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G212800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.71.8e-31132190159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh 
  Sobic.009G212800.1.p 132 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDRDDPSYVVTTYEGTHNHV 190
                           59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-34118192IPR003657WRKY domain
SuperFamilySSF1182902.09E-28124192IPR003657WRKY domain
PROSITE profilePS5081131.915127192IPR003657WRKY domain
SMARTSM007748.7E-36132191IPR003657WRKY domain
PfamPF031064.9E-25133189IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAAVGARPVL YHHPAPAGDA ASMSSYFSQG GSSTTSSSAS ASFSAALAPT TTTLAEQFDI  60
SEFLFDDAGV AGAPGVFADG SAPVVVSDAA AAAGGGAISA AAGSAAAAAE AVPERPRTER  120
IAFRTRSEIE ILDDGYKWRK YGKKSVKNSP NPRNYYRCST EGCNVKKRVE RDRDDPSYVV  180
TTYEGTHNHV SPSTVYYASQ DAASGRFFVA GTQPPGSLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-27122193778Probable WRKY transcription factor 4
2lex_A8e-27122193778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.122090.0ovary| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283630.0KJ728363.1 Zea mays clone pUT6645 WRKY transcription factor (WRKY82) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440147.11e-158hypothetical protein SORBIDRAFT_09g026830
SwissprotQ93WU94e-45WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLC5YUJ21e-158C5YUJ2_SORBI; Putative uncharacterized protein Sb09g026830
STRINGSb09g026830.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-41WRKY DNA-binding protein 50