PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G202000.1.p
Common NameSb09g025950, SORBIDRAFT_09g025950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GATA
Protein Properties Length: 413aa    MW: 42184.2 Da    PI: 6.1851
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G202000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.1e-18278312135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Sobic.009G202000.1.p 278 CLHCETDKTPQWRTGPLGPKTLCNACGVRYKSGRL 312
                           99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.101.0E-14272309IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.387272308IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-17272322IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-15274335No hitNo description
CDDcd002021.14E-13277324No hitNo description
PROSITE patternPS003440278303IPR000679Zinc finger, GATA-type
PfamPF003208.4E-16278312IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEVSAECAGG GRVRKEADLF LVDDLLDLPC DDEEEAQEAV VVGDGEGDGD GSKQQQAAAL  60
LGGRACGAGG EDGAGAGNAS NDSSAVTTAL DSCSNSLSVS GLADGDFSGG LCEPYDQLAE  120
LEWLSNYMGE DNFPTEDLKK LQLITGIPPA GTATATAPAP APAVVAAQQA QAQPAGGVLP  180
PEAPVPGKAR SKRSRIAPCS WASRLLVLPP PPASPPSPAS AAISPSESGT AAPAFPAKKP  240
SKPAKKKEAS TPSLPNNNAA AAAAAAASAA AAGEGRRCLH CETDKTPQWR TGPLGPKTLC  300
NACGVRYKSG RLVPEYRPAA SPTFVVSKHS NSHRKVLELR RQKEAHLHPH PHHQYQPQPP  360
QGPLAHIGGA GGGAALMHAP NPLMFDGPAG PLIGDDFLIH NHHIGPDFRQ LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440094.10.0hypothetical protein SORBIDRAFT_09g025950
TrEMBLC5Z1B90.0C5Z1B9_SORBI; Putative uncharacterized protein Sb09g025950
STRINGSb09g025950.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-47GATA transcription factor 12