PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G196100.1.p
Common NameSb09g025450, SORBIDRAFT_09g025450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 217aa    MW: 22783.7 Da    PI: 10.298
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G196100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.31.2e-3668123560
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                            l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGa+rnvP+G+grrkn+ 
  Sobic.009G196100.1.p  68 RLPCPRCLSRDTKFCYFNNYNVNQPRHFCRACHRYWTAGGAIRNVPIGSGRRKNRP 123
                           689**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.12769123IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3069122IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-2470122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MPARAAAACT GAAGIKLFGK VITTQPPQQP MQHAPPRLQQ QQASSGRGNN ADLLEEVARA  60
RAAAAEVRLP CPRCLSRDTK FCYFNNYNVN QPRHFCRACH RYWTAGGAIR NVPIGSGRRK  120
NRPVLLPPPA PHHAATATAS SADDNDHRSG SGSPPVFTSV FTAPYLGGSP SQFTTSPAYA  180
AAAAAAAGHP GTTTGQCLWL VATTDRPVAS DRAFLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G196100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270061e-158KJ727006.1 Zea mays clone pUT3982 C2C2-DOF transcription factor (DOF44) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021303940.11e-157dof zinc finger protein DOF2.4
TrEMBLA0A1Z5R3D71e-156A0A1Z5R3D7_SORBI; Uncharacterized protein
STRINGSb09g025450.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.11e-31Dof family protein