PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G187500.1.p
Common NameSb09g024690, SORBIDRAFT_09g024690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 425aa    MW: 45339.4 Da    PI: 6.2458
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G187500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS275.91.2e-84334222374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs...elykalppsetseknsseelaalkl..fs 85 
                           ++lLl+cA a++s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r +    ++ +a ++ + ++   ++++++++l  + 
  Sobic.009G187500.1.p  33 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACRLCGpagTIQAAAAAGAPAP--RERAMSVTELaeYI 119
                           699***********************************************99994430112333333333333..333344444466** PP

                  GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAee 171
                           +++P+++f++ + N +Il+av+g+ +vH++D++++ ++QWp+L++ L++Rp+gpp lRiT+ ++  ++      + ee+g rLa+fA++
  Sobic.009G187500.1.p 120 DLTPWHRFGFTASNGTILRAVAGSAAVHVVDLSVTRCMQWPTLIDMLSKRPGGPPALRITVPSARPAVppqLGVSDEEIGLRLANFAKS 208
                           ************************************************************999866668655566799*********** PP

                  GRAS 172 lgvpfefnvl.................vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                            gv++ef+v+                 ++++l+++  + ++L+++ gEal+Vn++  + ++       +  rd++L++v+ l+P +v+v
  Sobic.009G187500.1.p 209 KGVQLEFSVVqcaspsptssppkkqaaLCQDLASVlsNRQSLELRDGEALVVNCQSWIRHVA------PGSRDAFLDAVRALNPCLVTV 291
                           *****************99999887765566655577999****************999997......555788*************** PP

                  GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                           ++++ad++s+s+++r++ ++++++ lfd+l++++pr+s  r+  E++ +gr+i++vv +  a+  er e+ ++  er+++ GF +v ++
  Sobic.009G187500.1.p 292 TDEDADLDSPSLATRIAGCFDFHWILFDALDTSAPRDSPRRVEHEAA-VGRKIESVVGADDADGAERAESGARLAERMRRNGFASVGFD 379
                           ********************************************999.***************************************** PP

                  GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           e+aa+++++ll++++  g+ v+ e++ lvl+Wk++  v +SaW+
  Sobic.009G187500.1.p 380 EEAAAEVRRLLSEHA-TGWGVKREEDMLVLTWKGHGAVYTSAWT 422
                           ***************.99*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.8566403IPR005202Transcription factor GRAS
PfamPF035144.3E-8233422IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MEQELRTGGG GNLRAAHSSV CFSGALIDGP RIQQLLLHCA AALESNDVTL AQQAMWVLNN  60
IASSQGDPSQ RLTSWLLRAL VARACRLCGP AGTIQAAAAA GAPAPRERAM SVTELAEYID  120
LTPWHRFGFT ASNGTILRAV AGSAAVHVVD LSVTRCMQWP TLIDMLSKRP GGPPALRITV  180
PSARPAVPPQ LGVSDEEIGL RLANFAKSKG VQLEFSVVQC ASPSPTSSPP KKQAALCQDL  240
ASVLSNRQSL ELRDGEALVV NCQSWIRHVA PGSRDAFLDA VRALNPCLVT VTDEDADLDS  300
PSLATRIAGC FDFHWILFDA LDTSAPRDSP RRVEHEAAVG RKIESVVGAD DADGAERAES  360
GARLAERMRR NGFASVGFDE EAAAEVRRLL SEHATGWGVK REEDMLVLTW KGHGAVYTSA  420
WTPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-533542490475Protein SHORT-ROOT
5b3h_B9e-543542436421Protein SHORT-ROOT
5b3h_E9e-543542436421Protein SHORT-ROOT
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G187500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270020.0KJ727002.1 Zea mays clone pUT3978 GRAS transcription factor (GRAS62) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440025.10.0scarecrow-like protein 32
TrEMBLC5Z0F50.0C5Z0F5_SORBI; Uncharacterized protein
STRINGSb09g024690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.15e-90GRAS family protein