PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G182800.2.p
Common NameSb09g024290, SORBIDRAFT_09g024290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 218aa    MW: 23547.2 Da    PI: 5.0081
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G182800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.1e-1076125251
                           XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                           +++ + r+   NReA r++R++Kka  + Lee+vk+L a N++L  +l+ 
  Sobic.009G182800.2.p  76 EDSAKPRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQG 125
                           56667788899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-1573143No hitNo description
SMARTSM003384.8E-1075142IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.65777143IPR004827Basic-leucine zipper domain
PfamPF077168.6E-1377132IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-781125No hitNo description
CDDcd146861.32E-1182134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDDGADLPCQ LLFSHPEMPD SFDEFFSSAT TTTCTHTHSC NPPGPSAAMH THTCLHTHTQ  60
VLGSGGEDDD DAREEEDSAK PRKPLGNREA VRKYREKKKA HAAFLEEEVK KLRAANQQLL  120
RRLQGHAALE AEVARLRSLL LDVRGKIDAE VGVFPFQRPC SVGSVACADP ALCFNGNSEV  180
GGCWEESSRP AVADVSEGLR NSMDVVASFV SSDPLAE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0879560.0BT087956.1 Zea mays full-length cDNA clone ZM_BFb0329N19 mRNA, complete cds.
GenBankBT0605320.0BT060532.1 Zea mays full-length cDNA clone ZM_BFb0012N22 mRNA, complete cds.
GenBankBT0432560.0BT043256.1 Zea mays full-length cDNA clone ZM_BFc0133G19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441312.11e-160hypothetical protein SORBIDRAFT_09g024290
SwissprotQ8GTS23e-54BZP23_ARATH; Basic leucine zipper 23
TrEMBLC5Z0A91e-160C5Z0A9_SORBI; Putative uncharacterized protein Sb09g024290
STRINGSb09g024290.11e-160(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-36bZIP family protein